Recombinant Human Short transient receptor potential channel 6 (TRPC6) , partial
CAT:
399-CSB-MP1339HU-01
Size:
20 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Human Short transient receptor potential channel 6 (TRPC6) , partial
- CAS Number: 9000-83-3
- Gene Name: TRPC6
- UniProt: Q9Y210
- Expression Region: 543-592aa
- Organism: Homo sapiens
- Target Sequence: ARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWDPSDPQ
- Tag: C-terminal hFc-tagged
- Source: Mammalian cell
- Field of Research: Neuroscience
- Assay Type: Developed Protein
- Relevance: Thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Activated by diacylglycerol (DAG) in a membrane-delimited fashion, independently of protein kinase C. Seems not to be activated by intracellular calcium store depletion.
- Purity: Greater than 85% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Partial
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 34.7 kDa
- References & Citations: "TRPC6 G757D Loss-of-Function Mutation Associates with FSGS." Riehle M., Buescher A.K., Gohlke B.O., Kassmann M., Kolatsi-Joannou M., Braesen J.H., Nagel M., Becker J.U., Winyard P., Hoyer P.F., Preissner R., Krautwurst D., Gollasch M., Weber S., Harteneck C. J. Am. Soc. Nephrol. 27:2771-2783 (2016)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.