Recombinant Mycobacterium tuberculosis Steroid C26-monooxygenase (cyp125)

CAT:
399-CSB-EP351308MVZb0-03
Size:
1 mg

For Laboratory Research Only. Not for Clinical or Personal Use.

  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mycobacterium tuberculosis Steroid C26-monooxygenase (cyp125) - image 1

Recombinant Mycobacterium tuberculosis Steroid C26-monooxygenase (cyp125)

  • CAS Number:

    9000-83-3
  • Gene Name:

    cyp125
  • UniProt:

    P9WPP1
  • Expression Region:

    1-433aa
  • Organism:

    Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
  • Target Sequence:

    MSWNHQSVEIAVRRTTVPSPNLPPGFDFTDPAIYAERLPVAEFAELRSAAPIWWNGQDPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSSYENGVIPRFKNDIAREDIEVQRFVMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKIAAEAAAAGSGDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEMTGNEDPEYAHIDPKASSAELIGYAMKMAEEKAKNPADDIVTQLIQADIDGEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQWELYKKVRPETAADEIVRWATPVTAFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILRNPNPHVGFGGTGAHYCIGANLARMTINLIFNAVADHMPDLKPISAPERLRSGWLNGIKHWQVDYTGRCPVAH
  • Tag:

    N-terminal 10xHis-tagged
  • Source:

    E.coli
  • Field of Research:

    Others
  • Assay Type:

    Developed Protein
  • Relevance:

    Inhibits the classical pathway of complement activation and prevents accumulation of deposited C4.
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Length:

    Full Length
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    54.5 kDa
  • References & Citations:

    "Autotransporter passenger domain secretion requires a hydrophobic cavity at the extracellular entrance of the beta-domain pore." Zhai Y., Zhang K., Huo Y., Zhu Y., Zhou Q., Lu J., Black I., Pang X., Roszak A.W., Zhang X., Isaacs N.W., Sun F. Biochem J 435:577-587 (2011)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.