Recombinant Rabbit Methylosome subunit pICln (CLNS1A)

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS1409814-05	Recombinant Rabbit Methylosome subunit pICln (CLNS1A)
MBS1409814-01	Recombinant Rabbit Methylosome subunit pICln (CLNS1A)
MBS1409814-02	Recombinant Rabbit Methylosome subunit pICln (CLNS1A)
MBS1409814-03	Recombinant Rabbit Methylosome subunit pICln (CLNS1A)
MBS1409814-04	Recombinant Rabbit Methylosome subunit pICln (CLNS1A)
MBS9421364-02	Recombinant Human Methylosome protein 50
MBS9421364-01	Recombinant Human Methylosome protein 50
MBS1420574-02	Recombinant Human Methylosome protein 50
MBS9421364-04	Recombinant Human Methylosome protein 50
MBS1420574-01	Recombinant Human Methylosome protein 50

CAT:

399-CSB-EP637913RB-03

Size:

20 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Rabbit Methylosome subunit pICln (CLNS1A)

Gene Name: CLNS1A
UniProt: Q28678
Expression Region: 2-236aa
Organism: Oryctolagus cuniculus (Rabbit)
Target Sequence: SFLKSFPPPGPTEGLRHQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHAVSRDPNAYPQEHLYVMVNAKFGEESKELVADEEEDSDDDVEPISEFRFVPGDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source: E.coli
Field of Research: Others
Assay Type: In Stock Protein
Relevance: Involved in both the assembly of spliceosomal snRNPs and the methylation of Sm proteins. Chaperone that regulates the assembly of spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome, and thereby plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP (Sm core). In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP. Dissociation by the SMN complex of CLNS1A from the trapped Sm proteins and their transfer to an SMN-Sm complex triggers the assembly of core snRNPs and their transport to the nucleus.
Purity: Greater than 90% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length of Mature Protein
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 33.4 kDa
References & Citations: "Cloning and functional expression of a swelling-induced chloride conductance regulatory protein, plCln, from rabbit ocular ciliary epithelium." Wan X.L., Chen S., Sears M. Biochem. Biophys. Res. Commun. 239:692-696 (1997)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Rabbit Methylosome subunit pICln (CLNS1A), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on

Cat	Name
CSB-EP637913RB-03	Recombinant Rabbit Methylosome subunit pICln (CLNS1A)
CSB-EP637913RB-02	Recombinant Rabbit Methylosome subunit pICln (CLNS1A)
CSB-EP637913RB-01	Recombinant Rabbit Methylosome subunit pICln (CLNS1A)
CSB-EP859030HU-02	Recombinant Human Methylosome protein 50 (WDR77), partial
CSB-EP859030HU-01	Recombinant Human Methylosome protein 50 (WDR77), partial
CSB-EP859030HU-03	Recombinant Human Methylosome protein 50 (WDR77), partial
CSB-YP001183RBa0-03	Recombinant Rabbit Acrosin (ACR)
CSB-YP001183RBa0-02	Recombinant Rabbit Acrosin (ACR)
CSB-YP001183RBa0-01	Recombinant Rabbit Acrosin (ACR)
CSB-YP011629RBc7-03	Recombinant Rabbit Interleukin-2 (IL2)