Products for Research Use Only
RegisterLogin

Cathepsin E, Human (HEK293, His)

CAT: 0804-HY-P7750-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7750-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Cathepsin E Protein, Human (HEK293, His) is a human cathepsin E with a His tag. Cathepsin E is an aspartic protease and a member of the peptidase A1 family of proteases.[1].
Product Name Alternative
Cathepsin E Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cathepsin-e-protein-human-hek293-his.html
Purity
95.0
Smiles
SLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTFVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQLQNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVPHHHHHH
Molecular Formula
1510 (Gene_ID) P14091 (S20-P396) (Accession)
Molecular Weight
Approximately 42-48 kDa
References & Citations
[1]T Tsukuba, et al. New functional aspects of cathepsin D and cathepsin E. Mol Cells|[2]F Grüninger-Leitch, et al. Identification of beta-secretase-like activity using a mass spectrometry-based assay system. Nat Biotechnol. 2000 Jan;18 (1) :66-70.|[3]T Azuma, et al. Human gastric cathepsin E. Predicted sequence, localization to chromosome 1, and sequence homology with other aspartic proteinases. J Biol Chem
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P7751-01Cathepsin E, Mouse (HEK293, His)
HY-P74344Cathepsin E, Rat (HEK293, His)
HY-P7745A-01Cathepsin A, Human (HEK293, His)
HY-P7745-01Cathepsin A, Human (HEK293, His, solution)
HY-P7748A-01Cathepsin D, Human (HEK293, His)
HY-P7754A-01Cathepsin L1, Human (HEK293, His)
HY-P7993A-01Cathepsin B, Human (HEK293, His)
HY-P7756-01Cathepsin S, Human (HEK293, His)
HY-P7755-01Cathepsin L2, Human (HEK293, His)
HY-P74346-01Cathepsin A, Mouse (HEK293, His)

Alternative Products

CatalogName
MBS8113895-01Human Cathepsin A HEK293 Overexpression Lysate
MBS8113899-01Human Cathepsin S HEK293 Overexpression Lysate
MBS8113898-01Human Cathepsin L HEK293 Overexpression Lysate
MBS8113451-01Human Cathepsin V HEK293 Overexpression Lysate
MBS8114970-01Human Cathepsin D HEK293 Overexpression Lysate
MBS8113897-01Human Cathepsin C HEK293 Overexpression Lysate
MBS8113896-01Human Cathepsin B HEK293 Overexpression Lysate
MBS8113522-01Human Cathepsin Z/CTSZ HEK293 Overexpression Lysate
Z03591-50Cathepsin L, His, Human
Z03322-10Cathepsin B, His, Human

Popular Products