Recombinant Human Desmin (DES)

CAT: 0399-CSB-EP006735HUb0-01Size: 20 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0399-CSB-EP006735HUb0-01Size:20 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Abbreviation

Recombinant Human DES protein

Gene Name

DES

UniProt

P17661

Expression Region

2-470aa

Organism

Homo sapiens (Human)

Target Sequence

SQAYSSSQRVSSYRRTFGGAPGFPLGSPLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTRTPSSYGAGELLDFSLADAVNQEFLTTRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Muscle-specific type III intermediate filament essential for proper muscular structure and function. Plays a crucial role in maintaining the structure of sarcomeres, inter-connecting the Z-disks and forming the myofibrils, linking them not only to the sarcolemmal cytoskeleton, but also to the nucleus and mitochondria, thus providing strength for the muscle fiber during activity. In adult striated muscle they form a fibrous network connecting myofibrils to each other and to the plasma membrane from the periphery of the Z-line structures. May act as a sarcomeric microtubule-anchoring protein: specifically associates with detyrosinated tubulin-alpha chains, leading to buckled microtubules and mechanical resistance to contraction. Contributes to the transcriptional regulation of the NKX2-5 gene in cardiac progenitor cells during a short period of cardiomyogenesis and in cardiac side population stem cells in the adult. Plays a role in maintaining an optimal conformation of nebulette (NEB) on heart muscle sarcomeres to bind and recruit cardiac alpha-actin.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

59.4 kDa

References & Citations

"Desmin mutation responsible for idiopathic dilated cardiomyopathy." Li D., Tapscoft T., Gonzalez O., Burch P.E., Quinones M.A., Zoghbi W.A., Hill R., Bachinski L.L., Mann D.L., Roberts R. Circulation 100:461-464 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

UniProtKB · P17661

Desmin

DESM_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: P17661
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: DES
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: —
EC number: —
Processing: —
Secondary accessions: Q15787, Q549R7, Q549R8, Q549R9, Q8IZR1, Q8IZR6, Q8NES2, Q8NEU6, Q8TAC4, Q8TCX2, Q8TD99, Q9UHN5, Q9UJ80

Protein keywords

PTM

ADP-ribosylationMethylationPhosphoproteinUbl conjugation

Disease

CardiomyopathyDesmin-related myopathyDisease variantLimb-girdle muscular dystrophyMyofibrillar myopathy

Cellular component

Cell membraneCytoplasmIntermediate filamentMembraneNucleus

Domain

Coiled coil

Molecular function

Muscle protein

Technical term

Proteomics identificationReference proteome

Related Products

Catalog	Name
CSB-RA571495A0HU-01	DES Recombinant Monoclonal Antibody
CSB-CL006735HU	DES
CSB-PA13149A0Rb-01	DES Antibody
CSB-PA002117-01	DES Antibody
CSB-PA006735GA01HU	DES Antibody
CSB-PA002116-01	DES Antibody
CSB-E12871h-01	Human desmosine (DES) ELISA Kit
CSB-MA964079-01	DES Monoclonal Antibody
CSB-MA923561-01	DES Monoclonal Antibody
CSB-PA13149B0Rb-01	DES Antibody, HRP conjugated

Alternative Products

Catalog	Name
RPU41174-01	Recombinant Human Desmin (Des)
SIPA227Mu01-01	Recombinant Desmin (Des)
154336-01	Desmin (Des) Recombinant, Human
BP3397-50ug	Recombinant Human Desmin/DES
R0373h	Human DES / Desmin Recombinant Protein
TP726326	Desmin (DES) Human Recombinant Protein
BLT-04673P-01	Human DES (Desmin) - Recombinant Protein
PPT-12241	Human DES/Desmin Recombinant Protein
MBS954888-01	Recombinant Chicken Desmin (DES)
MBS1076515-01	Recombinant Bovine Desmin (DES)