Products for Research Use Only
RegisterLogin

IgG1, Human (CHO, C103S)

CAT: 0804-HY-P73903-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P73903-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
The IgG1 protein is the constant region of the immunoglobulin heavy chain and serves as a receptor during the recognition phase of humoral immunity. It triggers clonal expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells. IgG1 Protein, Human (CHO, C103S) is the recombinant human-derived IgG1 protein, expressed by CHO , with tag free.
Product Name Alternative
IgG1 Protein, Human (CHO, C103S), Human, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/igg1-protein-human-cho.html
Purity
97.00
Smiles
EPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Molecular Formula
3500 (Gene_ID) P01857-1 (E99-K330, C103S) (Accession)
Molecular Weight
Approximately 29-35 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P73143-01IgG1, Human (C103S, HEK293)
HY-P77526IgG1, Human (Biotinylated, C103S, HEK293)
HY-P704681IgG1, Human (C103S, N180A, HEK293, His)
HY-P704680IgG1, Human (C103S, D239E, L241E, HEK293)
HY-P705482IgG1, Human (Biotinylated, C103S, HEK293, Avi-His)
HY-P704682IgG1, Human (C103S, L117A, L118A, HEK293, His)
HY-P704683IgG1, Human (C103S, M135Y, S137T, T139E, HEK293, His)
HY-P704678IgG1, Human (C103S, L117F, L118E, P214S, HEK293, His)
HY-P704679IgG1, Human (C103S, M135Y, S137T, T139E, H316K, N317F, HEK293, His)
HY-P704684-01FITC-Labeled IgG1, Human (C103S, M135Y, S137T, T139E, H316K, N317F, HEK293, His)

Alternative Products

CatalogName
PH50782M0-01IgG1 Protein, Human, Recombinant (C103S)
TMPY-00820-01IgG1 Fc Protein, Human, Recombinant (C103S)
TMPY-05138-01IgG1 Fc Protein, Human, Recombinant (C103S), Biotinylated
TMPY-06893-01IgG1 Fc Protein, Human, Recombinant (C103S, Avi), Biotinylated
IG1-H52C9-500ugHuman IgG1 Fc (C103S) Protein, Flag Tag (MALS verified)
IG1-H52G6-500ugHuman IgG1 Fc (C103S) Protein, gD Tag (MALS verified)
IG1-H52H6-1mgHuman IgG1 Fc (C103S, L117A, L118A) Protein, His Tag
MBS8114068-01Human IgG1 CHO Overexpression Lysate
IG1-H52H7-200ugHuman IgG1 Fc (C103S, N180A) Protein, His Tag (MALS verified)
IG1-H52H8-1mgHuman IgG1 Fc (C103S, M135Y, S137T, T139E, H316K, N317F) Protein, His Tag

Popular Products