Recombinant Felis catus (Cat) Creatine kinase (CKM) , partial
CAT:
399-CSB-YP3993CA-01
Size:
20 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Felis catus (Cat) Creatine kinase (CKM) , partial
- CAS Number: 9000-83-3
- Gene Name: CKM
- UniProt: M3VYX8
- Expression Region: 179-424aa
- Organism: Felis catus (Cat) (Felis silvestris catus)
- Target Sequence: SIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
- Tag: Tag-Free
- Source: Yeast
- Field of Research: Others
- Assay Type: Developed Protein
- Purity: Greater than 85% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Partial
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 28.4 kDa
- References & Citations: "Initial sequence and comparative analysis of the cat genome." Pontius J.U., Mullikin J.C., Smith D.R., Lindblad-Toh K., Gnerre S., Clamp M., Chang J., Stephens R., Neelam B., Volfovsky N., Schaffer A.A., Agarwala R., Narfstrom K., Murphy W.J., Giger U., Roca A.L., Antunes A., Menotti-Raymond M. O'Brien S.J. Genome Res. 17:1675-1689 (2007)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.