Amylin (IAPP), feline (TFA)
CAT:
804-HY-P1871A-02
Size:
10 mg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
Amylin (IAPP), feline (TFA)
- UNSPSC Description: Amylin (IAPP), feline TFA is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline TFA is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline TFA is a regulatory peptide, which inhibits insulin and glucagon secretion[1].
- Target Antigen: Amylin Receptor
- Type: Peptides
- Related Pathways: GPCR/G Protein
- Applications: Metabolism-protein/nucleotide metabolism
- Field of Research: Metabolic Disease
- Assay Protocol: https://www.medchemexpress.com/amylin-iapp-feline-tfa.html
- Purity: 98.75
- Solubility: H2O
- Smiles: [KCNTATCATQRLANFLIRSSNNLGAILSPTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7) (TFA salt)]
- Molecular Weight: 3912.42 (free base)
- References & Citations: [1]Westermark P, et al. Islet amyloid polypeptide, islet amyloid, and diabetes mellitus. Physiol Rev. 2011 Jul;91(3):795-826.
- Shipping Conditions: Blue Ice
- Storage Conditions: -80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture)
- Clinical Information: No Development Reported