Recombinant Torque teno virus Probable protein VP2 (ORF2/3)
CAT:
399-CSB-BP313671TGW-01
Size:
1 mg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
Recombinant Torque teno virus Probable protein VP2 (ORF2/3)
- CAS Number: 9000-83-3
- Gene Name: ORF2/3
- UniProt: P0C674
- Expression Region: 1-286aa
- Organism: Torque teno virus (isolate Human/Japan/TRM1/1999) (TTV) (Torque teno virus genotype 1a)
- Target Sequence: MWTPPRNDQQYLNWQWYSSILSSHAAMCGCPDAVAHFNHLASVLRAPQNPPPPGPQRNLPLRRLPALPAAPEAPGDRAPWPMAGGAEGEDGGAGGDADHGGAAGGPEDADLLDAVAAAETLLEIPAKKPTPRAIESLEAYKSLTRNTTHRNSHSIPGTSDVASLARKLFRECNNNQQLLTFFQQAARDPGGTPRCTTPAKKGSKKKAYFSPQSSSSDESPRGKTRSRRKAGRKAQRKRRRPSPSSSSSSCSNSESWESNSDSCSTKSKKSTKIKISTLPCYQGGGI
- Tag: N-terminal 10xHis-tagged
- Source: Baculovirus
- Field of Research: Others
- Assay Type: Developed Protein
- Purity: Greater than 90% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Full Length
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 33.1 kDa
- References & Citations: "Phosphorylation of serine-rich protein encoded by open reading frame 3 of the TT virus genome." Asabe S., Nishizawa T., Iwanari H., Okamoto H. Biochem. Biophys. Res. Commun. 286:298-304 (2001)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.