Recombinant Mouse Solute carrier family 2, facilitated glucose transporter member 1 (Slc2a1), partial

• Product Name Alternative:

  Glucose transporter type 1, erythrocyte/brain

• Abbreviation:

  Recombinant Mouse Slc2a1 protein, partial

• Gene Name:

  Slc2a1

• UniProt:

  P17809

• Expression Region:

  451-492aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  KVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADSQV

• Tag:

  Tag-Free

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Signal Transduction

• Relevance:

  Facilitative glucose transporter, which is responsible for constitutive or basal glucose uptake (PubMed:17320047) . Has a very broad substrate specificity; can transport a wide range of aldoses including both pentoses and hexoses (By similarity) . Most important energy carrier of the brain: present at the blood-brain barrier and assures the energy-independent, facilitative transport of glucose into the brain (By similarity) .

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  4.5 kDa

• References & Citations:

  "Implications of glucose transporter protein type 1 (GLUT1) -haplodeficiency in embryonic stem cells for their survival in response to hypoxic stress." Heilig C., Brosius F., Siu B., Concepcion L., Mortensen R., Heilig K., Zhu M., Weldon R., Wu G., Conner D. Am. J. Pathol. 163:1873-1885 (2003)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial