Recombinant Schistosoma mansoni Antigenic integral membrane glycoprotein, partial

CAT:
399-CSB-EP328381SXQ1-01
Size:
20 µg

For Laboratory Research Only. Not for Clinical or Personal Use.

  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Schistosoma mansoni Antigenic integral membrane glycoprotein, partial - image 1

Recombinant Schistosoma mansoni Antigenic integral membrane glycoprotein, partial

  • Product Name Alternative:

    Antigen Sm25
  • Abbreviation:

    Recombinant Schistosoma mansoni Antigenic integral membrane glycoprotein, partial
  • UniProt:

    P23126
  • Expression Region:

    69-160aa
  • Organism:

    Schistosoma mansoni (Blood fluke)
  • Target Sequence:

    VNSEENSNSIITDEDYDHYNSSLDSSNNVKHSQEAFHRNSDPDGFPEYEFLNETSIEIKEELGQELHQLQLILDELSRRIRATPNSANKYMK
  • Tag:

    N-terminal 6xHis-Trx-tagged
  • Type:

    Developed Protein
  • Source:

    E.coli
  • Field of Research:

    Others
  • Relevance:

    Major antigen in the surface tegument.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    28.9 kDa
  • References & Citations:

    "Structure of Sm25, an antigenic integral membrane glycoprotein of adult Schistosoma mansoni." Omer Ali P., Jeffs S.A., Meadows H.M., Hollyer T., Owen C., Hackett F., Smithers S.R., Simpson A.J.G. Mol. Biochem. Parasitol. 45:215-222 (1991)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Partial