Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial, Biotinylated (Active)

CAT:
399-CSB-EP5116GUR-B-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial, Biotinylated (Active) - image 1
Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial, Biotinylated (Active) - image 2
Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial, Biotinylated (Active) - image 3
Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial, Biotinylated (Active) - image 4
Thumbnail 1
Thumbnail 2
Thumbnail 3
Thumbnail 4

Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial, Biotinylated (Active)

  • UniProt:

    D6S9W1
  • Expression Region:

    106-470aa
  • Organism:

    Finegoldia magna ATCC 53516
  • Target Sequence:

    KEETPETPETDSEEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYRYADALKKDNGEYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYRYADLLAKENGKYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFAEATAEAYRYADLLAKENGKYTADLEDGGYTINIRFAGKKVDEKPEEKEQVTIKENIYFEDGTVQTATFKGTFAEATAEAYRYADLLSKEHGKYTADLEDGGYTINIRFAG
  • Tag:

    N-terminal 10xHis-Avi-tagged
  • Source:

    E.coli
  • Field of Research:

    Others
  • Assay Type:

    Active Protein & In Stock Protein
  • Endotoxin:

    Less than 1.0 EU/ug as determined by LAL method.
  • Purity:

    Greater than 95% as determined by SDS-PAGE.
  • Activity:

    Yes
  • Bioactivity:

    Measured by its binding ability in a functional ELISA. Immobilized anti-CTLA4 antibody (CSB-RA006163MA2HU) at 2 μg/mL can bind Biotinylated Protein L. The EC50 is 1.123-1.761 ng/mL.
  • Length:

    Partial
  • Form:

    Lyophilized powder
  • Buffer:

    Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    44.2 kDa
  • References & Citations:

    Muzny D., Qin X., Buhay C., Dugan-Rocha S., Ding Y., Chen G., Hawes A., Holder M., Jhangiani S. Submitted to EMBL/GenBank/DDBJ databases (MAY-2010)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
  • CAS Number:

    9000-83-3