Login

Recombinant Dog Growth/differentiation factor 8 (MSTN)

CAT:
399-CSB-EP761481DOa0-02
Size:
100 µg
Price:
Ask
For price, please contact [email protected]
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Dog Growth/differentiation factor 8 (MSTN) - image 1
Recombinant Dog Growth/differentiation factor 8 (MSTN) - image 2
Thumbnail 1
Thumbnail 2

Recombinant Dog Growth/differentiation factor 8 (MSTN)

  • CAS Number: 9000-83-3
  • Gene Name: MSTN
  • UniProt: Q6UKZ8
  • Expression Region: 267-375aa
  • Organism: Canis lupus familiaris (Dog) (Canis familiaris)
  • Target Sequence: DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
  • Tag: N-terminal 6xHis-tagged
  • Source: E.coli
  • Field of Research: Cancer
  • Assay Type: Developed Protein
  • Relevance: Acts specifically as a negative regulator of skeletal muscle growth.
  • Purity: Greater than 90% as determined by SDS-PAGE.
  • Activity: Not Test
  • Length: Full Length of Mature Protein
  • Form: Liquid or Lyophilized powder
  • Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight: 16.5 kDa
  • References & Citations: "Cloning and characterization of canine myostatin (MSTN)." Perkins K.J., Khurana T.S. Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
  • Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.