Recombinant Human Myosin-7 (MYH7), partial

CAT:
399-CSB-BP015300HU-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Myosin-7 (MYH7), partial - image 1

Recombinant Human Myosin-7 (MYH7), partial

  • Product Name Alternative:

    (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain, cardiac muscle beta isoform) (MyHC-beta)
  • Abbreviation:

    Recombinant Human MYH7 protein, partial
  • Gene Name:

    MYH7
  • UniProt:

    P12883
  • Expression Region:

    1-109aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    MGDSEMAVFGAAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKQEFVKAKIVSREGGKVTAETEYGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKDRY
  • Tag:

    C-terminal 6xHis-tagged
  • Type:

    Developed Protein
  • Source:

    Baculovirus
  • Field of Research:

    Signal Transduction
  • Relevance:

    Myosins are actin-based motor molecules with ATPase activity essential for muscle contraction. Forms regular bipolar thick filaments that, together with actin thin filaments, constitute the fundamental contractile unit of skeletal and cardiac muscle.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    18.1 kDa
  • References & Citations:

    "Skip residues modulate the structural properties of the myosin rod and guide thick filament assembly." Taylor K.C., Buvoli M., Korkmaz E.N., Buvoli A., Zheng Y., Heinze N.T., Cui Q., Leinwand L.A., Rayment I. Proc. Natl. Acad. Sci. U.S.A. 112:E3806-E3815 (2015)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Partial