Recombinant Rhesus Macaque Pro-interleukin-16 [Cleaved into: Interleukin-16 protein (IL16) (Active)
CAT:
399-CSB-AP003191MOW-01
Size:
10 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Rhesus Macaque Pro-interleukin-16 [Cleaved into: Interleukin-16 protein (IL16) (Active)
- CAS Number: 9000-83-3
- Gene Name: IL16
- UniProt: O62675
- Expression Region: 510-630aa
- Organism: Macaca mulatta (Rhesus macaque)
- Target Sequence: SAASASAASDVSVESSAEATVYTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETIQPGDEILQLAGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQPKETTAAADS
- Tag: Tag-Free
- Source: E.Coli
- Field of Research: Immunology
- Assay Type: Active Protein & In Stock Protein
- Relevance: Interleukin-16 stimulates a migratory response in CD4+ lymphocytes, monocytes, and eosinophils. Primes CD4+ T-cells for IL-2 and IL-15 responsiveness. Also induces T-lymphocyte expression of interleukin 2 receptor. Ligand for CD4 (By similarity). {ECO:0000250}.; Pro-interleukin-16 is involved in cell cycle progression in T-cells. Appears to be involved in transcriptional regulation of SKP2 and is probably part of a transcriptional repression complex on the core promoter of the SKP2 gene. May act as a scaffold for GABPB1 (the DNA-binding subunit the GABP transcription factor complex) and HDAC3 thus maintaining transcriptional repression and blocking cell cycle progression in resting T-cells (By similarity). {ECO:0000250}.
- Endotoxin: Less than 1.0 EU/µg as determined by LAL method.
- Purity: >98% as determined by SDS-PAGE.
- Activity: Yes
- Bioactivity: Fully biologically active when compared to standard. The biological activity determined by a chemotaXIs bioassay using human peripheral T lymphocytes is in a concentration range of 1.0-100 ng/ml.
- Length: Full Length of Mature Protein
- Form: Lyophilized powder
- Buffer: Lyophilized from a 0.2 µm filtered PBS, pH 7.4
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Function: Interleukin-16 stimulates a migratory response in CD4+ lymphocytes, monocytes, and eosinophils. Primes CD4+ T-cells for IL-2 and IL-15 responsiveness. Also induces T-lymphocyte expression of interleukin 2 receptor. Ligand for CD4 (By similarity).
- Molecular Weight: 12.5 kDa
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.