Recombinant Nepenthes distillatoria Aspartic proteinase nepenthesin-1 (X20S, X45S, X48S, X51S, X53S, X98S, X107S) , partial
CAT:
399-CSB-EP302470NCC-02
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
Recombinant Nepenthes distillatoria Aspartic proteinase nepenthesin-1 (X20S, X45S, X48S, X51S, X53S, X98S, X107S) , partial
- CAS Number: 9000-83-3
- UniProt: P69476
- Expression Region: 1-164aa (X20N, X45C, X48C, X51C, X53N, X98C, X107S)
- Organism: Nepenthes distillatoria (Pitcher plant)
- Target Sequence: IGPSGVETTVYAGDGEYLMNLSIGTPAQPFSAIMDTGSDLIWTQCQPCTQCFNQSDPQGSSSFSTLPCGYGDSETQGSMGTETFTFGSVSIPNITFGCGEGPLPLPSQLDVAKYITLDLPIDPSAFDLCFQTPSDPSNLQIPTFVMHFDTGNSVVSFVSAQCGA
- Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
- Source: E.coli
- Field of Research: Others
- Assay Type: In Stock Protein
- Relevance: Extracellular proteinase found in the pitcher fluid of carnivorous plants. Digest prey for nitrogen uptake.
- Purity: Greater than 90% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Partial
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 24.7 kDa
- References & Citations: "Enzymic and structural characterization of nepenthesin, a unique member of a novel subfamily of aspartic proteinases." Athauda S.B.P., Matsumoto K., Rajapakshe S., Kuribayashi M., Kojima M., Kubomura-Yoshida N., Iwamatsu A., Shibata C., Inoue H., Takahashi K. Biochem. J. 381:295-306 (2004)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.