Recombinant Sheep Dipeptidase 1 (DPEP1)
CAT:
399-CSB-EP007123SH-01
Size:
20 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Sheep Dipeptidase 1 (DPEP1)
- CAS Number: 9000-83-3
- Gene Name: DPEP1
- UniProt: P43477
- Expression Region: 17-384aa
- Organism: Ovis aries (Sheep)
- Target Sequence: DQFRDNAVRLMQSTPVIDGHNDLPWALLKKFNNQLQDPRANLTSLNSTHTNIPKLKAGFVGAQFWSAYTPCDTQNKDSVKRTVEQIDVIQRMCQLYPETFLCVTDSAGIQQAFQEGKVASLVGVEGGHSIDSSLGVLRALYHLGMRYLTLTHSCNTPWADNWLVDTGEDKAQSQGLSSFGQSVVKEMNRLGIIIDLAHVSVATMEAALQLSKAPVIFSHSSAYSLCHHRRNVPDHVLQLVKQTGSLVMVNFYNDYVSCKAEANLSQVADHLDYIKKVAGAGAVGFGGDYDGVSRLPSGLEDVSKYPDLVAELLRRQWTEEEVRGALAENLLRVFKAVEQASDHKQAPGEEPIPLGQLEASCRTKYGYS
- Tag: N-terminal 6xHis-tagged
- Source: E.coli
- Field of Research: Cancer
- Assay Type: Developed Protein
- Relevance: Hydrolyzes a wide range of dipeptides. Hydrolyzes the conversion of leukotriene D4 to leukotriene E4. Hydrolyzes cystinyl-bis-glycine (cys-bis-gly) formed during glutathione degradation. Possesses also beta lactamase activity and hydrolytically inactivates beta-lactam antibiotics.; Independently of its dipeptidase activity, acts as an adhesion receptor for neutrophil recruitment from bloodstream into inflamed lungs and liver.
- Purity: Greater than 90% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Full Length of Mature Protein
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 43.3 kDa
- References & Citations: "Molecular cloning of sheep lung dipeptidase: a glycosyl phosphatidylinositol-anchored ectoenzyme that converts leukotriene D4 to leukotriene E4." An S., Schmidt F.J., Campbell B.J. Biochim. Biophys. Acta 1226:337-340 (1994)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.