N-terminal 6xHis-SUMO-tagged

CAT:

399-CSB-RP213344Ba

Size:

1 mg

Price:

Ask

For price, please contact [email protected]

Target Sequence: MMAHHHHHHMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGGSEFRT
Tag: N-terminal 6xHis-SUMO-tagged
Source: E.coli
Field of Research: Others
Assay Type: Developed Protein
Purity: Greater than 95% as determined by SDS-PAGE.
Activity: Not Test
Bioactivity: Not Test
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 13.1 kDa
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Cat	Name
CSB-RP213344Ba	N-terminal 6xHis-SUMO-tagged
CSB-MA000132M0m-01	Sumo tag Monoclonal Antibody
CSB-MA000131M0m-01	Sumo tag Monoclonal Antibody
CSB-MA000131M0m-02	Sumo tag Monoclonal Antibody
CSB-MA000132M0m-02	Sumo tag Monoclonal Antibody
CSB-EP722791HU-02	Recombinant Human N-terminal Xaa-Pro-Lys N-methyltransferase 2 (NTMT2)
CSB-EP722791HU-01	Recombinant Human N-terminal Xaa-Pro-Lys N-methyltransferase 2 (NTMT2)
CSB-EP722791HU-03	Recombinant Human N-terminal Xaa-Pro-Lys N-methyltransferase 2 (NTMT2)
CSB-EP005091HU-02	Recombinant Human CDKN2AIP N-terminal-like protein (CDKN2AIPNL)
CSB-EP005091HU-01	Recombinant Human CDKN2AIP N-terminal-like protein (CDKN2AIPNL)

Cat	Name
MBS7046828-1mg	N-terminal 6xHis-SUMO-tag
MBS7046853-01	N-terminal 6xHis-SUMO-tag and C-terminal Myc-tag
MBS7046853-03	N-terminal 6xHis-SUMO-tag and C-terminal Myc-tag
MBS7046853-04	N-terminal 6xHis-SUMO-tag and C-terminal Myc-tag
MBS7046853-05	N-terminal 6xHis-SUMO-tag and C-terminal Myc-tag
MBS7046853-02	N-terminal 6xHis-SUMO-tag and C-terminal Myc-tag
MBS7046830-1mg	N-terminal 6xHis-B2M-tag
MBS7046838-INQUIRE	N-terminal 6xHis-GST-tag
MBS7046849-INQUIRE	N-terminal 6xHis-Trx-tag
IFRIL6YSTNT6XHIS200ug	Ferret IL-6 Recombinant Yeast N-Terminal 6xHis Tagged