GNMT, Human (His)

• Description :

  Glycine N-methyltransferase (GNMT) is responsible for catalyzing the methylation of glycine, using S-adenosylmethionine (AdoMet) to generate N-methylglycine (sarcosine), and simultaneously producing S-adenosyl homocysteine AdoHcy. This reaction is complexly regulated by 5-methyltetrahydrofolate binding, highlighting the critical role of GNMT in the regulation of methyl metabolism. GNMT Protein, Human (His) is the recombinant human-derived GNMT protein, expressed by E. coli , with N-6*His labeled tag.

• Product Name Alternative :

  GNMT Protein, Human (His), Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/gnmt-protein-human-his.html

• Purity :

  98.0

• Smiles :

  MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTD

• Molecular Formula :

  27232 (Gene_ID) Q14749 (M1-D295) (Accession)

• Molecular Weight :

  Approximately 33-37 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Dry ice.

• Storage Conditions :

  Stored at -80°C for 1 year

• Scientific Category :

  Recombinant Proteins