Recombinant Mouse Histamine N-methyltransferase (Hnmt) | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS7016736-03	Recombinant Mouse Histamine H1 receptor (Hrh1)
MBS1336312-002mgEColi	Recombinant Mouse Histamine N-methyltransferase (Hnmt)
MBS1336312-01mgYeast	Recombinant Mouse Histamine N-methyltransferase (Hnmt)
MBS7016736-02	Recombinant Mouse Histamine H1 receptor (Hrh1)
MBS7016736-01	Recombinant Mouse Histamine H1 receptor (Hrh1)
MBS7016744-01	Recombinant Mouse Histamine H2 receptor (Hrh2)
MBS7016744-03	Recombinant Mouse Histamine H2 receptor (Hrh2)
MBS7016750-03	Recombinant Mouse Histamine H3 receptor (Hrh3)
MBS7016753-01	Recombinant Mouse Histamine H4 receptor (Hrh4)
MBS7016753-03	Recombinant Mouse Histamine H4 receptor (Hrh4)

Recombinant Mouse Histamine N-methyltransferase (Hnmt)

CAT:

399-CSB-EP010598MO-03

Size:

20 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Mouse Histamine N-methyltransferase (Hnmt)

Gene Name: Hnmt
UniProt: Q91VF2
Expression Region: 1-295aa
Organism: Mus musculus
Target Sequence: MASCMRSLFSDQGRYVESFRRFLNNSTEHQCMQEFMDKKLPGIIARIGEAKAEIKILSVGGGAGEVDLQILSKVQAQYPGICINNEVVEPSAEQIVKYKELVAKTSNMENIKFSWHKETSSEYQKRMLEEEEEPPKWDFIHMIQMLYYVKDIPATLKFFHGLLAASAKILIILVSGTSGWEKLWKKYGSRLPRDDLCQYVTSSDLAQILDDLGIKYECYDLVSTMDITDCFIDGNENGDLLWDFLTETCNFSKTAPLDLKAEIMKDLQEPEFSVKKEGKVLFNNNLSFIVVEANV
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source: E.coli
Field of Research: Others
Assay Type: In Stock Protein
Relevance: Inactivates histamine by N-methylation. Plays an important role in degrading histamine and in regulating the airway response to histamine.
Purity: Greater than 85% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 41.1 kDa
References & Citations: "Mouse histamine N-methyltransferase: cDNA cloning, expression, gene cloning and chromosomal localization." Wang L., Yan L., McGuire C., Kozak C.A., Wang M., Kim U.J., Siciliano M., Weinshilboum R.M. Inflamm. Res. 50:300-308 (2001)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Mouse Histamine N-methyltransferase (Hnmt), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-EP010598MO-02	Recombinant Mouse Histamine N-methyltransferase (Hnmt)
CSB-EP010598MO-03	Recombinant Mouse Histamine N-methyltransferase (Hnmt)
CSB-EP010598MO-01	Recombinant Mouse Histamine N-methyltransferase (Hnmt)
CSB-MC00282a0105	Histamine-OVA conjugate
CSB-MC00281a0105	Histamine-BSA conjugate
CSB-MP897568HU-02	Recombinant Human Histamine H3 receptor (HRH3)-VLPs
CSB-EP010737HU-02	Recombinant Human Histamine H1 receptor (HRH1), partial
CSB-EP010737HU-01	Recombinant Human Histamine H1 receptor (HRH1), partial
CSB-EP010737HU-03	Recombinant Human Histamine H1 receptor (HRH1), partial
CSB-EP010737RA1-02	Recombinant Rat Histamine H1 receptor (Hrh1), partial

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on