Recombinant Varicella-zoster virus Envelope glycoprotein L (gL)

CAT:
399-CSB-EP864287VAQ-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Varicella-zoster virus Envelope glycoprotein L (gL) - image 1

Recombinant Varicella-zoster virus Envelope glycoprotein L (gL)

  • Product Name Alternative:

    /
  • Abbreviation:

    Recombinant Varicella-zoster virus gL protein
  • Gene Name:

    GL
  • UniProt:

    Q9J3N1
  • Expression Region:

    23-160aa
  • Organism:

    Varicella-zoster virus (strain Oka vaccine) (HHV-3) (Human herpesvirus 3)
  • Target Sequence:

    LHLQDDTPLFFGAKPLSDVSLIITEPCVSSVYEAWDYAAPPVSNLSEALSGIVVKTKCPVPEVILWFKDKQMAYWTNPYVTLKGLTQSVGEEHKSGDIRDALLDALSGVWVDSTPSSTNIPENGCVWGADRLFQRVCQ
  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Signal Transduction
  • Relevance:

    The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Acts as a functional inhibitor of gH and maintains gH in an inhibited form. Upon binding to host integrins, gL dissociates from gH leading to activation of the viral fusion glycoproteins gB and gH.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    22.6 kDa
  • References & Citations:

    "A site of varicella-zoster virus vulnerability identified by structural studies of neutralizing antibodies bound to the glycoprotein complex gHgL." Xing Y., Oliver S.L., Nguyen T., Ciferri C., Nandi A., Hickman J., Giovani C., Yang E., Palladino G., Grose C., Uematsu Y., Lilja A.E., Arvin A.M., Carfi A. Proc. Natl. Acad. Sci. U.S.A. 112:6056-6061 (2015)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein