Recombinant Human Interferon-induced 35 kDa protein (IFI35) | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS1355527-01mgEColi	Recombinant Human Interferon-induced protein 44 (IFI44)
MBS9421558-03	Recombinant Human Interferon-induced transmembrane protein 1
MBS9421558-01	Recombinant Human Interferon-induced transmembrane protein 1
MBS9421558-02	Recombinant Human Interferon-induced transmembrane protein 1
MBS1355527-002mgEColi	Recombinant Human Interferon-induced protein 44 (IFI44)
MBS1355527-01mgYeast	Recombinant Human Interferon-induced protein 44 (IFI44)
MBS1355527-002mgBaculovirus	Recombinant Human Interferon-induced protein 44 (IFI44)
MBS1355527-002mgYeast	Recombinant Human Interferon-induced protein 44 (IFI44)
MBS9421558-04	Recombinant Human Interferon-induced transmembrane protein 1
JOT-EK7462Hu	Human Interferon-induced,EIF2AK2 ELISA KIT

Recombinant Human Interferon-induced 35 kDa protein (IFI35)

CAT:

399-CSB-EP011013HU-01

Size:

1 mg

Price:

Ask

For price, please contact [email protected].

Recombinant Human Interferon-induced 35 kDa protein (IFI35)

Gene Name: IFI35
UniProt: P80217
Expression Region: 2-286aa
Organism: Homo sapiens
Target Sequence: SAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQMSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG
Tag: N-terminal 6xHis-tagged
Source: E.coli
Field of Research: Cell Biology
Assay Type: Developed Protein
Relevance: Acts as a signaling pathway regulator involved in innate immune system response. In response to interferon IFN-alpha, associates in a complex with signaling pathway regulator NMI to regulate immune response; the complex formation prevents proteasome-mediated degradation of IFI35 and correlates with IFI35 dephosphorylation. In complex with NMI, inhibits virus-triggered type I interferon/IFN-beta production. In complex with NMI, negatively regulates nuclear factor NF-kappa-B signaling by inhibiting the nuclear translocation, activation and transcription of the NF-kappa-B subunit p65/RELA, resulting in the inhibition of endothelial cell proliferation, migration and re-endothelialization of injured arteries. Beside its role as an intracellular signaling pathway regulator, also functions extracellularly as damage-associated molecular patterns (DAMPs) to promote inflammation when actively released by macrophage to the extracellular space during cell injury and pathogen invasion. Macrophage-secreted IFI35 activates NF-kappa-B signaling in adjacent macrophages through Toll-like receptor 4/TLR4 activation, thereby inducing NF-kappa-B translocation from the cytoplasm into the nucleus which promotes the release of pro-inflammatory cytokines.
Purity: Greater than 90% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length of Mature Protein
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 37.4 kDa
References & Citations: "NMI and IFP35 serve as proinflammatory DAMPs during cellular infection and injury." XIahou Z., Wang X., Shen J., Zhu X., Xu F., Hu R., Guo D., Li H., Tian Y., Liu Y., Liang H. Nat. Commun. 8:950-950 (2017)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Human Interferon-induced 35 kDa protein (IFI35), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-EP011013HU-01	Recombinant Human Interferon-induced 35 kDa protein (IFI35)
CSB-EP011013HU-03	Recombinant Human Interferon-induced 35 kDa protein (IFI35)
CSB-EP011013HU-02	Recombinant Human Interferon-induced 35 kDa protein (IFI35)
CSB-EP011024HU1-02	Recombinant Human Interferon-induced transmembrane protein 1 (IFITM1), partial
CSB-RP012044h-02	Human Interferon-induced transmembrane protein 1 (IFITM1)
CSB-RP012044h-05	Human Interferon-induced transmembrane protein 1 (IFITM1)
CSB-RP012044h-04	Human Interferon-induced transmembrane protein 1 (IFITM1)
CSB-EP011024HU1-01	Recombinant Human Interferon-induced transmembrane protein 1 (IFITM1), partial
CSB-RP012044h-06	Human Interferon-induced transmembrane protein 1 (IFITM1)
CSB-RP012044h-01	Human Interferon-induced transmembrane protein 1 (IFITM1)

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on