Recombinant Rat OCIA domain-containing protein 1 (Ociad1)

CAT:
399-CSB-EP716840RA-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Rat OCIA domain-containing protein 1 (Ociad1) - image 1

Recombinant Rat OCIA domain-containing protein 1 (Ociad1)

  • Abbreviation:

    Recombinant Rat Ociad1 protein
  • Gene Name:

    Ociad1
  • UniProt:

    Q5XIG4
  • Expression Region:

    1-247aa
  • Organism:

    Rattus norvegicus (Rat)
  • Target Sequence:

    MNGRADFREPNAQVSRPIPDIGGGYIPTEEEWRLFAECHEECFWFRSVPLAATSMLITQGLISKGILSSHPKYGSIPKLIFACIVGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGELRRSLPPGHYTQKPKYDSNVSGQSSFGTSPAADNIEKETLPRYEPIPFSASMNESTPTGITDHIAQGPDPNLEDSPKRKSVTYEELRNKNRESYGVTLSHKTDPSVRPMQERGPQKEVKVNKYGDTWDE
  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Type:

    Developed Protein
  • Source:

    E.coli
  • Field of Research:

    Cancer
  • Relevance:

    Maintains stem cell potency . Increases STAT3 phosphorylation and controls ERK phosphorylation . May act as a scaffold, increasing STAT3 recruitment onto endosomes .
  • Endotoxin:

    Not test
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    35.1 kDa
  • References & Citations:

    "Quantitative phosphoproteomics of vasopressin-sensitive renal cells: regulation of aquaporin-2 phosphorylation at two sites." Hoffert J.D., Pisitkun T., Wang G., Shen R.-F., Knepper M.A. Proc. Natl. Acad. Sci. U.S.A. 103:7159-7164 (2006)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length