Products(NANP)5 peptide (25-aa, repeat-sequence peptide of ....(NANP)5 peptide (25-aa, repeat-sequence peptide of the P. falciparum circumsporozoite protein, CSP) conjugated with BSACAT:15-NANP51-BSASize:0.5 mgPrice:AskLogin for priceAvailability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.Dry Ice Shipment: NoPrevious slideNext slidePrevious slideNext slideRelated ProductsCATNameNANP51-BSA(NANP)5 peptide (25-aa, repeat-sequence peptide of the P. falciparum circumsporozoite protein, CSP) conjugated with BSANANP51-ARabbit Anti-(NANP)5 peptide (25-aa, repeat-sequence peptide of the P. falciparum circumsporozoite protein), CSP IgG, aff pureNANP101-P(NANP)10 (40-aa NANP repeat-sequence peptide of the P. falciparum circumsporozoite protein, CSP) peptide, pureNANP51-P(NANP)5 peptide (repeat-sequence peptide of the P. falciparum circumsporozoite protein, CSP) control/blocking peptideHEPC81-PMouse Hepcidin (HEPC) purified, 25-aa peptide (oxidized)HEPC61-P-1Human Hepcidin (HEPC) purified, 25-aa peptide (oxidized)HEPC61-PHuman Hepcidin (HEPC) purified, 25-aa peptide (oxidized)HEPC61-P-5Human Hepcidin (HEPC) purified, 25-aa peptide (oxidized)HEPC82-PMouse Hepcidin (HEPC) purified, 25-aa peptide (oxidized), BiotinylatedINSB25-PMouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS]Alternative ProductsCATNameDF13805-BPNANP Peptide33R-9755NANP Blocking PeptideMBS9631477-01NANP Blocking PeptideMBS3236078-01NANP Peptide - middle regionenz-009NANPMBS8560656-01NANPCSB-CL855041HUNANPMBS200642-01NANPAAP53100-100UGAAP53100-100UG - NANP Peptide - middle region20R-NR013NANP antibody