[email protected]

Contact Us Custom Services

Fetching Products...

we are looking for the best products for you...

Mouse Insulin C-peptide (57-87 aa) [EVEDPQVAQLELGGGPGAGDLQTLALEVAQQ ] | Gentaur

Mouse Insulin C-peptide (57-87 aa) [EVEDPQVAQLELGGGPGAGDLQTLALEVAQQ ]

CAT:

15-INSC35-P

Size:

500 µg

Price:

Ask

For price, please contact [email protected]

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Mouse Insulin C-peptide (57-87 aa) [EVEDPQVAQLELGGGPGAGDLQTLALEVAQQ ] - image 1

Related Products

Cat	Name
INSC35-P	Mouse Insulin C-peptide (57-87 aa) [EVEDPQVAQLELGGGPGAGDLQTLALEVAQQ ]
INSC23-M	Monoclonal Anti-Human Insulin C-peptide IgG, aff pure
INSB25-P	Mouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS]
SP-84141-5	C-terminal Proghrelin Isoform Peptide, mouse
INSA21-A	Anti-Human/mouse/rat Insulin chain A peptide IgG, aff pure
INSLM21-N-20	Recombinant Mouse/Rat Insulin
CRP21-P	Mouse C-Reactive Protein (CRP) control peptide
INSB22-M	Monoclonal Anti-Human/mouse/rat Insulin chain B peptide IgG, aff pure
AB-23252-P	Mouse aurora kinase C (Aurkc) Control/blocking peptide
IRAP11-P	Rat IRAP (Insulin regulated aminopeptidase) Control/blocking peptide #1

Alternative Products

Cat	Name
035-53	Insulin-1 C-Peptide (Mouse)
H-035-53	Insulin-1 C-Peptide (Mouse) - Antibody
sc-52033	Insulin C Peptide (1H8)
035-65	Insulin-2 C-Peptide (Rat)
G-035-53	Insulin-1 C-Peptide (Mouse) - Purified IgG Antibody
AF5109-BP	Insulin Peptide
MBS630055-02	C Peptide(-Hyperproinsulinemia, Insulin Precursor, Proinsulin)
MBS630055-01	C Peptide(-Hyperproinsulinemia, Insulin Precursor, Proinsulin)
MBS6009384-01	Insulin-like 6, C-Peptide, Prepro (Insulin-like Peptide 6, Insulin-like Peptide INSL6, INSL6, Relaxin/insulin-like Factor 1, RIF1)
MBS6012518-01	Insulin-like 6, C-Peptide, Prepro (Insulin-like Peptide 6, Insulin-like Peptide INSL6, INSL6, Relaxin/insulin-like Factor 1, RIF1)