Recombinant Human Apoptosis regulator BAX (BAX) | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS1340813-002mgEColi	Recombinant Human Apoptosis-enhancing nuclease
MBS1340813-5x1mgEColi	Recombinant Human Apoptosis-enhancing nuclease
MBS556256-03	Recombinant Human Apoptosis-Inducing Factor
MBS9421264-03	Recombinant Human Apoptosis-enhancing nuclease
MBS1340813-1mgEColi	Recombinant Human Apoptosis-enhancing nuclease
MBS556256-02	Recombinant Human Apoptosis-Inducing Factor
MBS9421264-04	Recombinant Human Apoptosis-enhancing nuclease
MBS1340813-01mgEColi	Recombinant Human Apoptosis-enhancing nuclease
MBS556256-01	Recombinant Human Apoptosis-Inducing Factor
MBS9421264-01	Recombinant Human Apoptosis-enhancing nuclease

Recombinant Human Apoptosis regulator BAX (BAX)

CAT:

399-CSB-CF002573HU(A4)-01

Size:

100 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Human Apoptosis regulator BAX (BAX)

Gene Name: BAX
UniProt: Q07812
Expression Region: 1-192aa
Organism: Homo sapiens
Target Sequence: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
Tag: N-terminal 10xHis-tagged
Source: in vitro E.coli expression system
Field of Research: Cancer
Assay Type: CF Transmembrane Protein & Developed Protein
Relevance: Plays a role in the mitochondrial apoptotic process. Under normal conditions, BAX is largely cytosolic via constant retrotranslocation from mitochondria to the cytosol mediated by BCL2L1/Bcl-xL, which avoids accumulation of toxic BAX levels at the mitochondrial outer membrane (MOM). Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis.
Purity: Greater than 90% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 23.3 kDa
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Human Apoptosis regulator BAX (BAX), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-CF002573HU(A4)-01	Recombinant Human Apoptosis regulator BAX (BAX)
CSB-CF002573HU(A4)-02	Recombinant Human Apoptosis regulator BAX (BAX)
CSB-CF002573HU(A4)c0-02	Recombinant Human Apoptosis regulator BAX (BAX)
CSB-CF002573HU(A4)e0-01	Recombinant Human Apoptosis regulator BAX (BAX)
CSB-CF002573HU(A4)c0-01	Recombinant Human Apoptosis regulator BAX (BAX)
CSB-CF002573HU(A4)e0-02	Recombinant Human Apoptosis regulator BAX (BAX)
CSB-EP021347HU-01	Recombinant Human Apoptosis regulatory protein Siva (SIVA1)
CSB-EP021347HU-02	Recombinant Human Apoptosis regulatory protein Siva (SIVA1)
CSB-EP819883HU-03	Recombinant Human Apoptosis-enhancing nuclease (AEN), partial
CSB-EP819883HU-02	Recombinant Human Apoptosis-enhancing nuclease (AEN), partial

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on