Recombinant Human Fibronectin (FN1), partial | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS968146-02	Recombinant Human Fibronectin
MBS955729-03	Recombinant Human Fibronectin
MBS968146-03	Recombinant Human Fibronectin
MBS141426-04	Recombinant Human Fibronectin
MBS7609130-04	Recombinant Human Fibronectin
MBS947867-04	Recombinant Human Fibronectin
MBS955729-04	Recombinant Human Fibronectin
MBS7609130-03	Recombinant Human Fibronectin
MBS7613600-03	Recombinant Human Fibronectin
MBS141426-02	Recombinant Human Fibronectin

Recombinant Human Fibronectin (FN1), partial

CAT:

399-CSB-EP008759HU1-01

Size:

1 mg

Price:

Ask

For price, please contact [email protected].

Recombinant Human Fibronectin (FN1), partial

Gene Name: FN1
UniProt: P02751
Expression Region: 732-911aa
Organism: Homo sapiens
Target Sequence: TASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTGTPRSDTVPSPR
Tag: N-terminal 6xHis-tagged
Source: E.coli
Field of Research: Cancer
Assay Type: In Stock Protein
Relevance: Fibronectins bind cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin. Fibronectins are involved in cell adhesion, cell motility, opsonization, wound healing, and maintenance of cell shape.
Purity: Greater than 90% as determined by SDS-PAGE.
Activity: Not Test
Length: Partial of the full length of 723-911AA
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 23.6 kDa
References & Citations: "Phenotypic and genetic alterations in mammary stroma: implications for tumour progression." Schor S.L., Schor A.M. Breast Cancer Res. 3:373-379 (2001)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Human Fibronectin (FN1), partial, falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-EP008759HU1-01	Recombinant Human Fibronectin (FN1), partial
CSB-EP008759HU1-02	Recombinant Human Fibronectin (FN1), partial
CSB-EP008759HU1-03	Recombinant Human Fibronectin (FN1), partial
CSB-EP008759HU-WD-03	Recombinant Human Fibronectin (FN1), partial (Active)
CSB-AP005751HU-03	Recombinant Human Fibronectin (FN1), partial (Active)
CSB-MP008759HU-WD1-02	Recombinant Human Fibronectin (FN1), partial (Active)
CSB-MP008759HU-WD-01	Recombinant Human Fibronectin (FN1), partial (Active)
CSB-MP008759HU-WD-03	Recombinant Human Fibronectin (FN1), partial (Active)
CSB-MP008759HU-WD1-03	Recombinant Human Fibronectin (FN1), partial (Active)
CSB-EP008759HU-WD-02	Recombinant Human Fibronectin (FN1), partial (Active)

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on