IL-21, Mouse

• Description :

  IL-21 Protein, Mouse is a regulatory cytokine thought to play a role in the transition between innate and adaptive immunity.

• Product Name Alternative :

  IL-21 Protein, Mouse, Mouse, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/il-21-protein-mouse-129a-a.html

• Purity :

  98.0

• Smiles :

  HKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS

• Molecular Formula :

  60505 (Gene_ID) Q9ES17 (H18-S146) (Accession)

• Molecular Weight :

  Approximately 15.1 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations :

  [1]Tang W, et al. Expression, purification and identification of recombinant mouse interleukin 21 protein in E. coli. Cell Mol Immunol. 2006 Aug;3 (4) :311-5.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins