Recombinant Mouse Angiopoietin-related protein 4 (Angptl4) | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS1324314-002mgEColi	Recombinant Mouse Angiopoietin-related protein 3 (Angptl3)
MBS1324314-002mgYeast	Recombinant Mouse Angiopoietin-related protein 3 (Angptl3)
MBS1324314-01mgYeast	Recombinant Mouse Angiopoietin-related protein 3 (Angptl3)
MBS1446143-01	Recombinant Mouse Angiopoietin-related protein 6 (Angptl6)
MBS1446143-03	Recombinant Mouse Angiopoietin-related protein 6 (Angptl6)
MBS1446143-05	Recombinant Mouse Angiopoietin-related protein 6 (Angptl6)
MBS1333585-002mgYeast	Recombinant Mouse Angiopoietin-related protein 1 (Angptl1)
MBS1364861-002mgEColi	Recombinant Mouse Angiopoietin-related protein 2 (Angptl2)
MBS1364861-002mgYeast	Recombinant Mouse Angiopoietin-related protein 2 (Angptl2)
MBS1385381-01	Recombinant Mouse Angiopoietin-related protein 7 (Angptl7)

Recombinant Mouse Angiopoietin-related protein 4 (Angptl4)

CAT:

399-CSB-EP4186MO-01

Size:

1 mg

Price:

Ask

For price, please contact [email protected].

Recombinant Mouse Angiopoietin-related protein 4 (Angptl4)

Gene Name: Angptl4
UniProt: Q9Z1P8
Expression Region: 24-410aa
Organism: Mus musculus
Target Sequence: QGRPAQPEPPRFASWDEMNLLAHGLLQLGHGLREHVERTRGQLGALERRMAACGNACQGPKGKDAPFKDSEDRVPEGQTPETLQSLQTQLKAQNSKIQQLFQKVAQQQRYLSKQNLRIQNLQSQIDLLAPTHLDNGVDKTSRGKRLPKMTQLIGLTPNATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS
Tag: C-terminal 6xHis-tagged
Source: E.coli
Field of Research: Others
Assay Type: In Stock Protein
Relevance: Mediates inactivation of the lipoprotein lipase LPL, and thereby plays a role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism. May also play a role in regulating glucose homeostasis and insulin sensitivity. Inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage. Upon heterologous expression, inhibits the adhesion of endothelial cell to the extracellular matrix (ECM), and inhibits the reorganization of the actin cytoskeleton, formation of actin stress fibers and focal adhesions in endothelial cells that have adhered to ANGPTL4-containing ECM (in vitro). Depending on context, may modulate tumor-related angiogenesis (Probable). ; [ANGPTL4 N-terminal chain]: Mediates inactivation of the lipoprotein lipase LPL, and thereby plays an important role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism. Has higher activity in LPL inactivation than the uncleaved protein.
Purity: Greater than 90% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length of Mature Protein
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 44.4 kDa
References & Citations: "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y. Science 309:1559-1563 (2005)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Mouse Angiopoietin-related protein 4 (Angptl4), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-EP4186MO-03	Recombinant Mouse Angiopoietin-related protein 4 (Angptl4)
CSB-EP4186MO-01	Recombinant Mouse Angiopoietin-related protein 4 (Angptl4)
CSB-EP874172MO-02	Recombinant Mouse Angiopoietin-related protein 3 (Angptl3)
CSB-EP4186MO-02	Recombinant Mouse Angiopoietin-related protein 4 (Angptl4)
CSB-EP874172MO-03	Recombinant Mouse Angiopoietin-related protein 3 (Angptl3)
CSB-EP874172MO-01	Recombinant Mouse Angiopoietin-related protein 3 (Angptl3)
CSB-EP891539HU-01	Recombinant Human Angiopoietin-related protein 2 (ANGPTL2)
CSB-EP891539HU-03	Recombinant Human Angiopoietin-related protein 2 (ANGPTL2)
CSB-MP822824HU-02	Recombinant Human Angiopoietin-related protein 6 (ANGPTL6)
CSB-EL001712MO-04	Mouse Angiopoietin-related protein 4 (ANGPTL4) ELISA Kit

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on