Products for Research Use Only
RegisterLogin

NIP7, Human (His)

CAT: 0804-HY-P71162Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P71162Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
NIP7 is essential for precise processing of 34S pre-rRNA and assembly of 60S ribosomal subunits. As a monomer, NIP7 interacts with preribosomal complexes, may bind to RNA, and binds to key protein partners, including NOL8, SBDS, and FTSJ3. NIP7 Protein, Human (His) is the recombinant human-derived NIP7 protein, expressed by E. coli , with N-6*His labeled tag.
Product Name Alternative
NIP7 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/nip7-protein-human-his.html
Smiles
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
Molecular Formula
51388 (Gene_ID) Q9Y221-1 (M1-T180) (Accession)
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-RS09301NIP7 Human Pre-designed siRNA Set A
HY-RS26426Nip7 Rat Pre-designed siRNA Set A
HY-RS19924Nip7 Mouse Pre-designed siRNA Set A
HY-P7670-01BNIP3/NIP3, Human (His)
HY-P76688UBE2F, Human (His)
HY-P71535-01TEAD4, Human (His)
HY-P76754-01CABP5, Human (His)
HY-P76504-01NAPG, Human (His)
HY-P75930-01MTSS1, Human (His)
HY-P75991-01PSME2, Human (His)

Alternative Products

CatalogName
TMPJ-01395-01NIP7 Protein, Human, Recombinant (His)
PR00946Recombinant Human NIP7 Protein, N-His
KMH1456-01Recombinant Human NIP7 Protein, His Tag
P517230NIP7; KD93 Protein (N-His, Human)
AR09455PU-NNIP7 (1-180, His-tag) Human Protein
PV028325NIP7 Protein Vector (Human) (pPB-C-His)
PV028326NIP7 Protein Vector (Human) (pPB-N-His)
PV028328NIP7 Protein Vector (Human) (pPM-C-His)
PKSH032811-01Recombinant Human NIP7/KD93 Protein (His Tag)
E53A03158NIP7, 1-180aa, Human, His tag, E.coli

Popular Products