Recombinant Human immunodeficiency virus 1 Protein Rev (rev) (D62T, T68A)

Recombinant Human immunodeficiency virus 1 Protein Rev (rev) (D62T, T68A)

• CAS Number: 9000-83-3
• Gene Name: rev
• UniProt: Q9DKF2
• Expression Region: 1-107aa (D62T, T68A)
• Organism: Human immunodeficiency virus 1
• Target Sequence: MAGRSGDSDEALLRAVRIIKILYQSNPYPEPRGTRQARKNRRRRWRARQNQIHSISERILSTCLGRPAEPVPLQLPPLERLHITDSERGGTSGTQQPQGTTEGVGSP
• Tag: N-terminal 10xHis-tagged
• Source: E.coli
• Field of Research: Others
• Assay Type: In Stock Protein
• Purity: Greater than 90% as determined by SDS-PAGE.
• Activity: Not Test
• Length: Full Length
• Form: Liquid or Lyophilized powder
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight: 18.0 kDa
• References & Citations: "A recent outbreak of human immunodeficiency virus type 1 infection in southern China was initiated by two highly homogeneous, geographically separated strains, circulating recombinant form AE and a novel BC recombinant." Piyasirisilp S., McCutchan F.E., Carr J.K., Sanders-Buell E., Liu W., Chen J., Wagner R., Wolf H., Shao Y., Lai S., Beyrer C., Yu X.F. J. Virol. 74:11286-11295 (2000)
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.