Recombinant Mouse Chitinase domain-containing protein 1 (Chid1) | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS1402242-01	Recombinant Mouse Acidic mammalian chitinase (Chia)
MBS1402242-02	Recombinant Mouse Acidic mammalian chitinase (Chia)
MBS1402242-03	Recombinant Mouse Acidic mammalian chitinase (Chia)
MBS1402242-04	Recombinant Mouse Acidic mammalian chitinase (Chia)
MBS2612634-01	Mouse Chitinase ELISA Kit
MBS2612634-02	Mouse Chitinase ELISA Kit
MBS2612634-03	Mouse Chitinase ELISA Kit
MBS1402242-05	Recombinant Mouse Acidic mammalian chitinase (Chia)
enz-031	Chitinase
HY-P2797B	Chitinase

Recombinant Mouse Chitinase domain-containing protein 1 (Chid1)

CAT:

399-CSB-MP835645MO-01

Size:

1 mg

Price:

Ask

For price, please contact [email protected].

Recombinant Mouse Chitinase domain-containing protein 1 (Chid1)

Gene Name: Chid1
UniProt: Q922Q9
Expression Region: 20-393aa
Organism: Mus musculus
Target Sequence: TLSKSDAKKAASKMLLEKTQFSDKPVQDRGLVVTDIKAEDVVLEHRSYCSSRARERNFAGEVLGYVTPWNSHGYDVAKVFGSKFTQISPVWLQLKRRGREMFEITGLHDVDQGWMRAVKKHAKGVRIVPRLLFEDWTYDDFRNVLDSEDEIEELSKTVAQVAKNQHFDGFVVEVWSQLLSQKHVGLIHMLTHLAEALHQARLLVILVIPPAVTPGTDQLGMFTHKEFEQLAPILDGFSLMTYDYSTSQQPGPNAPLSWIRACVQVLDPKSQWRSKILLGLNFYGMDYAASKDAREPVIGARYVQTLKDHRPRVVWDSQAAEHFFEYKKNRGGRHVVFYPTLKSLQVRLELARELGVGVSIWELGQGLDYFYDLL
Tag: N-terminal 6xHis-Myc-tagged
Source: Mammalian cell
Field of Research: Immunology
Assay Type: In Stock Protein
Relevance: Saccharide- and LPS-binding protein with possible roles in pathogen sensing and endotoxin neutralization. Ligand-binding specificity relates to the length of the oligosaccharides, with preference for chitotetraose
Purity: Greater than 85% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length of Mature Protein
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 46.9 kDa
References & Citations: "A large-scale, gene-driven mutagenesis approach for the functional analysis of the mouse genome." Hansen J., Floss T., Van Sloun P., Fuchtbauer E.M., Vauti F., Arnold H.H., Schnutgen F., Wurst W., von Melchner H., Ruiz P. Proc. Natl. Acad. Sci. U.S.A. 100:9918-9922 (2003)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Mouse Chitinase domain-containing protein 1 (Chid1), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-MP842057MO-03	Recombinant Mouse Chitinase-like protein 4 (Chil4)
CSB-MP842057MO-02	Recombinant Mouse Chitinase-like protein 4 (Chil4)
CSB-MP842057MO-01	Recombinant Mouse Chitinase-like protein 4 (Chil4)
CSB-BP835645MO-02	Recombinant Recombinant Mouse Chitinase domain-containing protein 1 (Chid1)
CSB-EP835645MO-03	Recombinant Mouse Chitinase domain-containing protein 1 (Chid1)
CSB-MP835645MO-02	Recombinant Mouse Chitinase domain-containing protein 1 (Chid1)
CSB-EP835645MO-02	Recombinant Mouse Chitinase domain-containing protein 1 (Chid1)
CSB-YP842057MO-01	Recombinant Mouse Chitinase-3-like protein 4 (Chi3l4)
CSB-EP835645MO-01	Recombinant Mouse Chitinase domain-containing protein 1 (Chid1)
CSB-BP835645MO-01	Recombinant Recombinant Mouse Chitinase domain-containing protein 1 (Chid1)

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on