Recombinant Human Mitochondrial thiamine pyrophosphate carrier (SLC25A19)

CAT:
399-CSB-CF864025HU-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Mitochondrial thiamine pyrophosphate carrier (SLC25A19) - image 1

Recombinant Human Mitochondrial thiamine pyrophosphate carrier (SLC25A19)

  • Product Name Alternative:

    (Mitochondrial uncoupling protein 1) (Solute carrier family 25 member 19)
  • Abbreviation:

    Recombinant Human SLC25A19 protein
  • Gene Name:

    SLC25A19
  • UniProt:

    Q9HC21
  • Expression Region:

    1-320aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCNVFHCMNRTASQR
  • Tag:

    N-terminal 10xHis-tagged
  • Type:

    CF Transmembrane Protein & In Stock Protein
  • Source:

    In vitro E.coli expression system
  • Field of Research:

    Others
  • Relevance:

    Mitochondrial transporter mediating uptake of thiamine pyrophosphate (ThPP) into mitochondria.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    37.0 kDa
  • References & Citations:

    "Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression." Hendrickson S.L., Lautenberger J.A., Chinn L.W., Malasky M., Sezgin E., Kingsley L.A., Goedert J.J., Kirk G.D., Gomperts E.D., Buchbinder S.P., Troyer J.L., O'Brien S.J. PLoS One 5:e12862-e12862 (2010)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length