Recombinant Mouse Tumor necrosis factor (TNF) , partial (Active)

Recombinant Mouse Tumor necrosis factor (TNF) , partial (Active)

• CAS Number: 9000-83-3
• Gene Name: TNF
• UniProt: P06804
• Expression Region: 89-235aa
• Organism: Mus musculus
• Target Sequence: DKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
• Tag: Tag-Free
• Source: E.coli
• Field of Research: Cancer
• Assay Type: Active Protein & In Stock Protein
• Relevance: Tumor Necrosis Factor (TNF) is a member of the Tumor Necrosis Factor family. TNF eXIsts as a homotrimer and interacts with SPPL2B. TNF is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. TNF is a key cytokine in the development of several inflammatory disorders. It contributes to the development of type 2 diabetes throught its effects on insulin resistance and fatty acid metabolism.
• Endotoxin: Less than 1.0 EU/µg as determined by LAL method.
• Purity: Greater than 95% as determined by SDS-PAGE.
• Activity: Yes
• Bioactivity: The ED50 as determined in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is 2-8 pg/ml.
• Length: Partial
• Form: Lyophilized powder
• Buffer: Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Function: Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cacheXIa, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.; FUNCTION
• Molecular Weight: 16.4 kDa
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.