Recombinant Macaca fascicularis G protein-coupled receptor 20 (GPR20) -VLPs (Active)
CAT:
399-CSB-MP5431MOV-02
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No








Recombinant Macaca fascicularis G protein-coupled receptor 20 (GPR20) -VLPs (Active)
- CAS Number: 9000-83-3
- Gene Name: GPR20 Cynomolgus-VLPs
- UniProt: XP_015310747.1
- Expression Region: 1-359aa
- Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
- Target Sequence: MPSVSPVGPSAGAVPNATAVTTVWTNASGLEVPLFHLFARLDEELHGTFPGLWLALMAVHGAIFLVGLVLNGLALYVFCCRTQAKTPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLHCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGMTGGRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLRQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHASLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHRGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGPEA
- Tag: C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
- Source: Mammalian cell
- Field of Research: Signal Transduction
- Assay Type: MP-VLP Transmembrane Protein & Active Protein & In Stock Protein
- Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
- Purity: The purity information is not available for VLPs proteins.
- Activity: Yes
- Bioactivity: Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis GPR20 at 10 μg/mL can bind Anti-GPR20 recombinant antibody (CSB-RA860774MA1HU). The EC50 is 3.549 - 6.542 ng/mL.The VLPs (CSB-MP3838) is negative control.
- Length: Full Length
- Form: Lyophilized powder
- Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle miXIng. Avoid vigorous shaking or vorteXIng.
- Molecular Weight: 40.2 kDa
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.