Recombinant Macaca fascicularis Myoglobin (MB)
CAT:
399-CSB-EP013529MOV-02
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Macaca fascicularis Myoglobin (MB)
- CAS Number: 9000-83-3
- Gene Name: MB
- UniProt: P02150
- Expression Region: 2-154aa
- Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
- Target Sequence: GLSDGEWQLVLNVWGKVEADIPSHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGVTVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLELISESIIQVLQSKHPGDFGADAQGAMNKALELFRNDMAAKYKELGFQG
- Tag: C-terminal 6xHis-tagged
- Source: E.coli
- Field of Research: Others
- Assay Type: In Stock Protein
- Relevance: Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.
- Purity: Greater than 90% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Full Length of Mature Protein
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 23.9 kDa
- References & Citations: "The myoglobin of primates. 3. Cercopithecidae (Old World monkeys): Papio anubis (olive baboon) and Macaca fascicularis (=irus, crab-eating monkey)." Romero-Herrera A.E., Lehmann H. Biochim. Biophys. Acta 278:465-481 (1972)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.