IL-11, Mouse

CAT:
804-HY-P73155-01
Size:
2 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
IL-11, Mouse - image 1

IL-11, Mouse

  • Description :

    IL-11 protein is a multifunctional cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation to increase platelet production. It also contributes to liver cell proliferation in response to liver injury. IL-11 Protein, Mouse is the recombinant mouse-derived IL-11 protein, expressed by E. coli , with tag free.
  • Product Name Alternative :

    IL-11 Protein, Mouse, Mouse, E. coli
  • UNSPSC :

    12352202
  • Type :

    Recombinant Proteins
  • Assay Protocol :

    https://www.medchemexpress.com/cytokines/il-11-protein-mouse.html
  • Purity :

    96
  • Smiles :

    PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL
  • Molecular Formula :

    16156 (Gene_ID) P47873/NP_032376.1 (P22-L199) (Accession)
  • Molecular Weight :

    Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.
  • Shipping Conditions :

    Room temperature in continental US; may vary elsewhere.
  • Storage Conditions :

    Stored at -20°C for 2 years
  • Scientific Category :

    Recombinant Proteins