Recombinant Human CD9 antigen (CD9)

CAT: 0399-CSB-CF004969HU-01Size: 20 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0399-CSB-CF004969HU-01Size:20 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Product Name Alternative

5H9 antigen; Cell growth-inhibiting gene 2 protein; Leukocyte antigen MIC3; Motility-related protein; MRP-1; Tetraspanin-29; Tspan-29; p24; CD antigen CD9

Abbreviation

Recombinant Human CD9 protein

Gene Name

CD9

UniProt

P21926

Expression Region

2-228aa

Organism

Homo sapiens (Human)

Target Sequence

PVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & Developed Protein

Source

In vitro E.coli expression system

Field of Research

Cardiovascular

Relevance

Integral membrane protein associated with integrins, which regulates different processes, such as sperm-egg fusion, platelet activation and aggregation, and cell adhesion. Present at the cell surface of oocytes and plays a key role in sperm-egg fusion, possibly by organizing multiprotein complexes and the morphology of the membrane required for the fusion. In myoblasts, associates with CD81 and PTGFRN and inhibits myotube fusion during muscle regeneration. In macrophages, associates with CD81 and beta-1 and beta-2 integrins, and prevents macrophage fusion into multinucleated giant cells specialized in ingesting complement-opsonized large particles. Also prevents the fusion between mononuclear cell progenitors into osteoclasts in charge of bone resorption. Acts as a receptor for PSG17. Involved in platelet activation and aggregation. Regulates paranodal junction formation. Involved in cell adhesion, cell motility and tumor metastasis.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

UniProtKB · P21926

CD9 antigen

CD9_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: P21926
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: CD9
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: —
EC number: —
Processing: —
Secondary accessions: D3DUQ9, Q5J7W6, Q96ES4

Protein keywords

Technical term

3D-structureDirect protein sequencingProteomics identificationReference proteome

Biological process

Cell adhesionFertilization

Cellular component

Cell membraneMembraneSecreted

PTM

Disulfide bondGlycoproteinLipoproteinPalmitate

Domain

TransmembraneTransmembrane helix

Related Products

Catalog	Name
CSB-CF004969MO-01	Recombinant Mouse CD9 antigen (Cd9)
CSB-EP004969MO1b1-01	Recombinant Mouse CD9 antigen (Cd9), partial
CSB-MP004969MO-01	Recombinant Mouse CD9 antigen (Cd9) -VLPs
CSB-EL004969HU-01	Human CD9 antigen (CD9) ELISA kit
CSB-EL004969MO-01	Mouse CD9 antigen (CD9) ELISA kit
CSB-CL004969HU	CD9
CSB-RA004969A0HU-01	CD9 Recombinant Monoclonal Antibody
CSB-RA004969MA1HU-01	CD9 Recombinant Monoclonal Antibody
CSB-PA004969KA01HU	CD9 Antibody
CSB-PA004969LA11HU-01	CD9 Antibody

Alternative Products

Catalog	Name
MBS967249-01	Recombinant Human CD9 antigen (CD9)
BLT-07713P-01	Human CD9 (Cd9 Antigen) - Recombinant Protein
GTR19122838-01	Recombinant Human CD9 antigen (CD9), partial
R15351h	Human CD9 / CD9 antigen Recombinant Protein
MBS7011195-01	Recombinant Pig CD9 antigen (CD9)
MBS7011194-01	Recombinant Mouse CD9 antigen (Cd9)
AP2C97-01	Recombinant Feline CD9 Antigen (CD9)
MBS948049	Recombinant Cat CD9 antigen (CD9)
MBS7011196-01	Recombinant Rat CD9 antigen (Cd9)
MBS7011191-01	Recombinant Bovine CD9 antigen (CD9)