PFDN1, Mouse (His)

• Description :

  The PFDN1 protein is a key player in the immune response, presenting antigen to CD4 T cells by accommodating 10-30 residue peptides in its peptide-binding cleft. PFDN1 plays a role in the endocytic pathway of antigen-presenting cells, specifically in the exogenous antigen presentation pathway, forming heteromers with three MHC class II molecules and a CD74 trimer in the endoplasmic reticulum. PFDN1 Protein, Mouse (His) is the recombinant mouse-derived PFDN1 protein, expressed by E. coli , with N-His labeled tag.

• Product Name Alternative :

  PFDN1 Protein, Mouse (His), Mouse, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/pfdn1-protein-mouse-his.html

• Purity :

  92.30

• Smiles :

  MAASVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEVIHNQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ

• Molecular Formula :

  67199 (Gene_ID) Q9CQF7 (M1-Q122) (Accession)

• Molecular Weight :

  Approximately 16 kDa

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins