Products for Research Use Only
RegisterLogin

IFN-lambda 1/IL-29, Human

CAT: 0804-HY-P7026-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7026-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
IFN-lambda 1 (IL-29) is a member of the Type-III interferon family. IFN-lambda 1 signals through a heterodimeric receptor complex comprising IFNλ receptor 1 (IFNLR1) and IL-10 receptor subunit-β (IL-10RB) . When IFN-lambda 1 binds with the receptor complex, Jak1 and Tyk2 will be activated, and leads to subsequent tyrosine phosphorylation of the IFN-λR1, and activation of STAT1 and STAT2[1]. IFN-lambda 1 modulates immunity in infections and autoimmune diseases[2]. IFN-lambda 1/IL-29 Protein, Human is a recombinant human IFN-lambda 1 (G20-T200) without any tag, which is produced in E. coli.
Product Name Alternative
IFN-lambda 1/IL-29 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ifn-lambda1-il-29-protein-human.html
Purity
97.0
Smiles
GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
Molecular Formula
282618 (Gene_ID) Q8IU54 (G20-T200) (Accession)
Molecular Weight
Approximately 19.8 kDa
References & Citations
[1]Dantas AT, et al. Interferons and systemic sclerosis: correlation between interferon gamma and interferon-lambda 1 (IL-29) . Autoimmunity. 2015;48 (7) :429-33.|[2]Srinivas S, et al. Interferon-lambda1 (interleukin-29) preferentially down-regulates interleukin-13 over other T helper type 2 cytokine responses in vitro. Immunology. 2008 Dec;125 (4) :492-502.|[3]Donnelly RP, et al. Interferon-lambda: a new addition to an old family. J Interferon Cytokine Res. 2010 Aug;30 (8) :555-64.|[4]Wu Q, et al. Serum IFN-λ1 is abnormally elevated in rheumatoid arthritis patients. Autoimmunity. 2013 Feb;46 (1) :40-3.|[5]Kelm NE, et al. The role of IL-29 in immunity and cancer. Crit Rev Oncol Hematol. 2016 Oct;106:91-8.|[6]Lopušná K, et al. Interferons lambda, new cytokines with antiviral activity. Acta Virol. 2013;57 (2) :171-9.|[7]Xu L, et al. Interleukin-29 Enhances Synovial Inflammation and Cartilage Degradation in Osteoarthritis. Mediators Inflamm. 2016;2016:9631510.|[8]Yu Y, et al. Hepatitis B virus induces a novel inflammation network involving three inflammatory factors, IL-29, IL-8, and cyclooxygenase-2. J Immunol. 2011 Nov 1;187 (9) :4844-60.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P72552-01IFN-lambda 3/IL-28B, Human (HEK293, His)
HY-P72553-01IFN-lambda 2/IL-28A, Human (HEK293, His)
HY-P700120AF-01Animal-Free IFN-lambda 3/IL-28B, Human (His)
HY-P700119AF-01Animal-Free IFN-lambda 2/IL-28A, Human (His)
HY-P73201IFN-lambda 3/IL-28B, Human (P.pastoris, His)
HY-P77005IFN-lambda 2/IL-28A, Human (P.pastoris, His)
HY-P74851IFN-lambda 3/IL-28B, Mouse (HEK293, His)
HY-P700204AF-01Animal-Free IFN-lambda 3/IL-28B, Mouse (His)
HY-P7991A-01IFN-lambda 2/IL-28A, Mouse (HEK293, N-His)
HY-P700203AF-01Animal-Free IFN-lambda 2/IL-28A, Mouse (His)

Alternative Products

CatalogName
RC217-18IFN lambda 1 (IL-29), human
PH2021-.01Recombinant Human IL-29/IFN-lambda 1
HA210970-01Human IL-29/IFN-lambda 1, Tag Free
1598-IL-025/CFRecombinant Human IL-29/IFN-lambda 1 CF
PROTQ8IU54-250ugHuman IL-29/IFN-lambda 1 Recombinant Protein
NBP2-34996-5ugRecombinant Human IL-29/IFN-lambda 1 Protein
DY7246Human IL-29/IFN-lambda 1 DuoSet ELISA
GTR18800496Human IL-29/IFN lambda 1 ELISA Kit
E900977PRecombinant Human IFN-lambda 1/IL-29 Protein
MBS9135846-01Human IL-29/IFN-lambda 1 ELISA Kit

Popular Products