Recombinant Human GTPase KRas (KRAS), partial | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS1265094-05mg	Recombinant human GTPase KRas
MBS9421982-02	Recombinant Human GTPase ERas
MBS9421982-04	Recombinant Human GTPase ERas
MBS960501-01	Recombinant Human GTPase ERas
MBS9421981-04	Recombinant Human GTPase KRas
MBS9421982-01	Recombinant Human GTPase ERas
MBS1265094-005mg	Recombinant human GTPase KRas
MBS1265094-1mg	Recombinant human GTPase KRas
MBS9421981-03	Recombinant Human GTPase KRas
MBS9421982-03	Recombinant Human GTPase ERas

Recombinant Human GTPase KRas (KRAS), partial

CAT:

399-CSB-YP012493HU-01

Size:

1 mg

Price:

Ask

For price, please contact [email protected].

Recombinant Human GTPase KRas (KRAS), partial

Gene Name: KRAS
UniProt: P01116
Expression Region: 2-185aa (G13D)
Organism: Homo sapiens
Target Sequence: TEYKLVVVGAGDVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC
Tag: N-terminal 6xHis-tagged
Source: Yeast
Field of Research: Epigenetics and Nuclear Signaling
Assay Type: Developed Protein
Relevance: Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the regulation of cell proliferation .Curated2 Publications
Purity: Greater than 95% as determined by SDS-PAGE.
Activity: Not Test
Length: Partial of Isoform 2B
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 23.0 kDa
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Human GTPase KRas (KRAS), partial, falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-EP016070HU-02	Recombinant Human GTPase NRas (NRAS)
CSB-EP016070HU-03	Recombinant Human GTPase NRas (NRAS)
CSB-EP016070HU-01	Recombinant Human GTPase NRas (NRAS)
CSB-RP139774h-02	Recombinant Human GTPase ERas (ERAS), partial
CSB-RP139774h-03	Recombinant Human GTPase ERas (ERAS), partial
CSB-YP012493HU-03	Recombinant Human GTPase KRas (KRAS), partial
CSB-EP012493HU1-01	Recombinant Human GTPase KRas (KRAS), partial
CSB-EP012493HU1-03	Recombinant Human GTPase KRas (KRAS), partial
CSB-YP012493HU-01	Recombinant Human GTPase KRas (KRAS), partial
CSB-YP012493HU-02	Recombinant Human GTPase KRas (KRAS), partial

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on