Recombinant Francisella tularensis subsp. holarctica Chaperonin GroEL (groEL), partial | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
Oneq-VH327-OneqVH32750D	Francisella tularensis
PCR-VH327-PCRVH32796D	Francisella tularensis
FR120	Francisella tularensis
BIO001	Francisella tularensis
Oneq-VH327-OneqVH327100D	Francisella tularensis
Oneq-VH327-OneqVH327150D	Francisella tularensis
PCR-VH327-PCRVH32748D	Francisella tularensis
BIO002	Francisella tularensis and Francisella like
AS16 4035	Anti-Francisella tularensis
MBS1307044-002mgBaculovirus	Recombinant Francisella tularensis subsp. tularensis Ferrochelatase (hemH)

Recombinant Francisella tularensis subsp. holarctica Chaperonin GroEL (groEL), partial

CAT:

399-CSB-EP311342FCO-03

Size:

20 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Francisella tularensis subsp. holarctica Chaperonin GroEL (groEL), partial

Gene Name: groEL
UniProt: P94798
Expression Region: 184-376aa
Organism: Francisella tularensis subsp. holarctica (strain LVS)
Target Sequence: EDELDVVEGMQFDRGYLSPYFATNQENMTTDLENPYILIVDKKISNIRDLLPILEGVSKSGRALLIIAEDVESEALATLVVNNMRGVVKVCAVKAPGFGDRRKAMLEDIATLTGATFVSEDLSMKLEETNMEHLGTASRVQVTKDNTTIIDGAGEKEAIAKRINVIKANIAEANSDYDREKLQERLAKLSGGV
Tag: C-terminal 6xHis-tagged
Source: E.coli
Field of Research: Others
Assay Type: Developed Protein
Relevance: Together with its co-chaperonin GroES, plays an essential role in assisting protein folding. The GroEL-GroES system forms a nano-cage that allows encapsulation of the non-native substrate proteins and provides a physical environment optimized to promote and accelerate protein folding.
Purity: Greater than 95% as determined by SDS-PAGE.
Activity: Not Test
Bioactivity: Not Test
Length: Partial
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 28.1 kDa
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Francisella tularensis subsp. holarctica Chaperonin GroEL (groEL), partial, falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-EP393003FDX-02	Recombinant Francisella tularensis subsp. tularensis 60 kDa chaperonin (groEL), partial
CSB-EP393003FDX-01	Recombinant Francisella tularensis subsp. tularensis 60 kDa chaperonin (groEL), partial
CSB-EP393003FDX-03	Recombinant Francisella tularensis subsp. tularensis 60 kDa chaperonin (groEL), partial
CSB-EP689721FAAA-02	Recombinant Francisella tularensis subsp. tularensis LPS-assembly protein lptD (lptD), partial
CSB-EP689721FAAA-01	Recombinant Francisella tularensis subsp. tularensis LPS-assembly protein lptD (lptD), partial
CSB-EP689721FAAA-03	Recombinant Francisella tularensis subsp. tularensis LPS-assembly protein lptD (lptD), partial
CSB-EP311342FCO-03	Recombinant Francisella tularensis subsp. holarctica Chaperonin GroEL (groEL), partial
CSB-EP311342FCO-02	Recombinant Francisella tularensis subsp. holarctica Chaperonin GroEL (groEL), partial
CSB-EP311342FCO-01	Recombinant Francisella tularensis subsp. holarctica Chaperonin GroEL (groEL), partial
CSB-EP022917FDW-02	Recombinant Francisella tularensis subsp. novicida Succinyl-CoA ligase [ADP-forming] subunit beta (sucC)

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on