Recombinant Human Syndecan-4 (SDC4) , partial (Active)

Recombinant Human Syndecan-4 (SDC4) , partial (Active)

• Gene Name: SDC4
• UniProt: P31431
• Expression Region: 19-145aa
• Organism: Homo sapiens
• Target Sequence: ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE
• Tag: Tag-Free
• Source: E.Coli
• Field of Research: Signal Transduction
• Assay Type: Active Protein & In Stock Protein
• Relevance: Cell surface proteoglycan that bears heparan sulfate.
• Endotoxin: Less than 1.0 EU/µg as determined by LAL method.
• Purity: >95% as determined by SDS-PAGE.
• Activity: Yes
• Bioactivity: Fully biologically active when compared to standard. The specific activity is determined by binding ability in a functional ELISA. Immobilized rHuSYND4 at 500 ng/ml (100 μl/well) can bind rHubFGF with a linear range of 0.1-10 ng/ml.
• Length: Partial
• Form: Lyophilized powder
• Buffer: Lyophilized from a 0.2 µm filtered PBS, pH 7.4
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Function: Cell surface proteoglycan that bears heparan sulfate. Regulates exosome biogenesis in concert with SDCBP and PDCD6IP
• Molecular Weight: 13.9 kDa
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.