Recombinant Mouse Leukemia inhibitory factor (Lif) (Active)
CAT:
399-CSB-MP012928MO-WD
Size:
50 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No

Recombinant Mouse Leukemia inhibitory factor (Lif) (Active)
- CAS Number: 9000-83-3
- Gene Name: LIF
- UniProt: P09056
- Expression Region: 24-203aa
- Organism: Mus musculus
- Target Sequence: SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
- Tag: Tag free
- Source: Mammalian cell
- Field of Research: Others
- Assay Type: Active Protein & In Stock Protein
- Endotoxin: ≤10 EU/mg by the LAL method
- Purity: Greater than 95% as determined by SDS-PAGE.
- Activity: Yes
- Bioactivity: Measured in the M1 cell differentiation assay. The ED50 is ≤0.2ng/ml.
- Length: Full Length of Mature Protein
- Form: Lyophilized powder
- Buffer: Lyophilized from a 0.2 μm filtered solution containing PBS, 5%mannitoland0.01% Tween 80, pH7.4
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 19.9 kDa
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.