Products for Research Use Only
RegisterLogin

ACVR2B, Mouse (HEK293, His)

CAT: 0804-HY-P75536-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P75536-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
ACVR2B is a type II member of the TGF-β family of receptor Serine/Threonine kinases. ACVR2B binds to activins and growth differentiation factors (GDF), which in turn activate type I receptors, activating downstream molecule SMAD2/3[1]. ACVR2B Protein, Mouse (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag. It consists of 134 amino acids (M1-T134) .
Product Name Alternative
ACVR2B Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/acvr2b-protein-mouse-hek293-his.html
Purity
90.00
Smiles
SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEPGGPEVTYEPPPTAPT
Molecular Formula
11481 (Gene_ID) P27040-1 (S19-T134) (Accession)
Molecular Weight
23-37 kDa
References & Citations
[1]Johanna Magga, et al. Systemic Blockade of ACVR2B Ligands Protects Myocardium from Acute Ischemia-Reperfusion Injury. Mol Ther. 2019 Mar 6;27 (3) :600-610.|[2]Oddrun Elise Olsen, et al. Activin A inhibits BMP-signaling by binding ACVR2A and ACVR2B. Cell Commun Signal. 2015 Jun 6;13:27.|[3]Rafael Barreto, et al. ACVR2B/Fc counteracts chemotherapy-induced loss of muscle and bone mass. Sci Rep. 2017 Oct 31;7 (1) :14470.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P77292ACVR2B, Cynomolgus (HEK293, His)
HY-P703681-01RIIB/ACVR2B, Rat (HEK293, His)
HY-P7456-01ACVR2B, Human/Cynomolgus (HEK293, His)
HY-P77290ACVR2B, Rhesus Macaque (HEK293)
HY-P77291ACVR2B, Cynomolgus (HEK293, Fc)
HY-P704973-01ACVR2B, Human/Cynomolgus (Biotinylated, HEK293, His-Avi)
HY-P72813-01ACVR2B, Human/Cynomolgus (HEK293, hFc)
HY-P703707ACVR2B, Human/Cynomolgus (HEK293, mFc)
HY-P703956-01ACVR2B, Human/Cynomolgus (Biotinylated, HEK293, mFc)
HY-P75539ACVR1, Mouse (HEK293, His-hFc)

Alternative Products

CatalogName
MBS8116435-01Mouse ACVR2B HEK293 Overexpression Lysate
TMPY-01281-01ACVR2B Protein, Mouse, Recombinant (His)
Z05983-500Activin RIIB/ACVR2B, His, Mouse
E40MOP1173Mouse ACVR2B Protein, His Tag
P521973ACVR2B Protein (C-His, Mouse)
UA010246-01ACVR2B His Tag Protein, Mouse
MOP1172Mouse ACVR2B Protein, Fc & His Tag
TMPY-01022-01ACVR2B Protein, Mouse, Recombinant (His & hFc)
E45M53414M2-100ACVR2B Protein, Mouse, Recombinant (His Tag)
PR17333Recombinant Mouse ACVR2B Protein, C-His

Popular Products