GM-CSF, Mouse

• Description :

  GM-CSF Protein is a hematopoietic growth factor and immunomodulator. By binding to specific receptors on the surface of target cells, GM-CSF Protein activates intracellular signaling pathways to regulate cell proliferation, differentiation, maturation, and function. GM-CSF Protein plays an important role in the hematopoietic process and the immune system. GM-CSF Protein, Mouse is a recombinant GM-CSF Protein expressed by E. coli without a tag[1][2][3][4].

• Product Name Alternative :

  GM-CSF Protein, Mouse, Mouse, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/gm-csf-protein-mouse.html

• Purity :

  98.00

• Smiles :

  APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK

• Molecular Formula :

  12981 (Gene_ID) Q14AD9 (A18-K141) (Accession)

• Molecular Weight :

  Approximately 14-15 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations :

  [1]Shi Y, et al. Granulocyte-macrophage colony-stimulating factor (GM-CSF) and T-cell responses: what we do and don't know. Cell Res. 2006 Feb;16 (2) :126-33.|[2]Gasson JC, et al. Human granulocyte-macrophage colony-stimulating factor (GM-CSF) : regulation of expression. Prog Clin Biol Res. 1990;338:27-41.|[3]Gomez-Cambronero J, et al. Granulocyte-macrophage colony-stimulating factor is a chemoattractant cytokine for human neutrophils: involvement of the ribosomal p70 S6 kinase signaling pathway. J Immunol. 2003 Dec 15;171 (12) :6846-55.|[4]Shiomi A, et al. GM-CSF as a therapeutic target in autoimmune diseases. Inflamm Regen. 2016 Jul 5;36:8.|[5]Na YR, et al. GM-CSF Induces Inflammatory Macrophages by Regulating Glycolysis and Lipid Metabolism. J Immunol. 2016 Nov 15;197 (10) :4101-4109. doi: 10.4049/jimmunol.1600745IF: 3.6 Q2 . Epub 2016 Oct 14. Erratum in: J Immunol. 2017 Apr 1;198 (7) :3000.|[6]Reed J A, et al. Aerosolized GM-CSF ameliorates pulmonary alveolar proteinosis in GM-CSF-deficient mice[J]. American Journal of Physiology-Lung Cellular and Molecular Physiology, 1999, 276 (4) : L556-L563.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins