GM-CSF, Mouse

CAT: 0804-HY-P7361-01Size: 2 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0804-HY-P7361-01Size:2 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

GM-CSF Protein is a hematopoietic growth factor and immunomodulator. By binding to specific receptors on the surface of target cells, GM-CSF Protein activates intracellular signaling pathways to regulate cell proliferation, differentiation, maturation, and function. GM-CSF Protein plays an important role in the hematopoietic process and the immune system. GM-CSF Protein, Mouse is a recombinant GM-CSF Protein expressed by E. coli without a tag[1][2][3][4].

Product Name Alternative

GM-CSF Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gm-csf-protein-mouse.html

Purity

98.00

Smiles

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK

Molecular Formula

12981 (Gene_ID) Q14AD9 (A18-K141) (Accession)

Molecular Weight

Approximately 14-15 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Shi Y, et al. Granulocyte-macrophage colony-stimulating factor (GM-CSF) and T-cell responses: what we do and don't know. Cell Res. 2006 Feb;16 (2) :126-33.|[2]Gasson JC, et al. Human granulocyte-macrophage colony-stimulating factor (GM-CSF) : regulation of expression. Prog Clin Biol Res. 1990;338:27-41.|[3]Gomez-Cambronero J, et al. Granulocyte-macrophage colony-stimulating factor is a chemoattractant cytokine for human neutrophils: involvement of the ribosomal p70 S6 kinase signaling pathway. J Immunol. 2003 Dec 15;171 (12) :6846-55.|[4]Shiomi A, et al. GM-CSF as a therapeutic target in autoimmune diseases. Inflamm Regen. 2016 Jul 5;36:8.|[5]Na YR, et al. GM-CSF Induces Inflammatory Macrophages by Regulating Glycolysis and Lipid Metabolism. J Immunol. 2016 Nov 15;197 (10) :4101-4109. doi: 10.4049/jimmunol.1600745IF: 3.6 Q2 . Epub 2016 Oct 14. Erratum in: J Immunol. 2017 Apr 1;198 (7) :3000.|[6]Reed J A, et al. Aerosolized GM-CSF ameliorates pulmonary alveolar proteinosis in GM-CSF-deficient mice[J]. American Journal of Physiology-Lung Cellular and Molecular Physiology, 1999, 276 (4) : L556-L563.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Related Products

Catalog	Name
HY-P7016A-01	GM-CSF, Human
HY-P79087-01	GM-CSF, Canine
HY-P79256-01	GM-CSF, Pig
HY-P85190-01	GM-CSF Antibody (YA4882, Mouse)
HY-P990381	Anti-CSF2/GM-CSF Antibody
HY-P7016C-01	GM-CSF, Human (His)
HY-P7184-01	GM-CSF, Rhesus macaque
HY-P7094-01	GM-CSF, Rat (CHO)
HY-P78868-01	GM-CSF, Human (HEK293)
HY-P7016-01	GM-CSF, Human (CHO)

Alternative Products

Catalog	Name
600185	Mouse GM-CSF
PR27074-01	GM - CSF Mouse
300-308P-500ug	Mouse GM-CSF
MBS8575386-01	GM-CSF, Mouse
OM300757-01	GM CSF Mouse
IMSGMCSFR5UG	Mouse GM-CSF Recombinant
EA-2502	Mouse GM-CSF ELISA
BL10079_R-01	Recombinant Mouse GM-CSF
MBS9719250-01	Mouse GM-CSF protein
GTR19068733-01	GM-CSF

GM-CSF, Mouse

Related Products

Alternative Products

Popular Products