IL-5, Mouse

• Description :

  IL-5 Protein, Mouse is a hematopoietic growth factor expressed in Th2, mast cells and eosinophils.

• Product Name Alternative :

  IL-5 Protein, Mouse, Mouse, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/il-5-protein-mouse.html

• Purity :

  95.00

• Smiles :

  MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

• Molecular Formula :

  16191 (Gene_ID) P04401 (M21-G133) (Accession)

• Molecular Weight :

  Approximately 26.2 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations :

  [1]Yang S, et al. Canine interleukin-5: molecular characterization of the gene and expression of biologically active recombinant protein. J Interferon Cytokine Res. 2001 Jun;21 (6) :361-7.|[2]Seow HF, et al. Cloning and sequencing of an ovine interleukin-5 cDNA. DNA Seq. 1996;6 (6) :331-5.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins