S100A11, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


S100A11, Human
Description :
S100A11 Protein facilitates keratinocyte differentiation and cornification, forming homodimers via disulfide linkages. S100A11 Protein, Human is the recombinant human-derived S100A11 protein, expressed by E. coli , with tag free.Product Name Alternative :
S100A11 Protein, Human, Human, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsAssay Protocol :
https://www.medchemexpress.com/cytokines/s100a11-protein-human.htmlPurity :
95.0Smiles :
MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRTMolecular Formula :
6282 (Gene_ID) P31949 (M1-T105) (Accession)Molecular Weight :
Approximately 12 kDaShipping Conditions :
Room temperature in continental US; may vary elsewhere.Storage Conditions :
Stored at -20°C for 2 yearsScientific Category :
Recombinant Proteins

