Recombinant Human Leukocyte surface antigen CD47 (CD47), partial (Active)

• Product Name Alternative:

  Antigenic surface determinant protein OA3 (Integrin-associated protein) (IAP) (Protein MER6) (CD47)

• Abbreviation:

  Recombinant Human CD47 protein, partial (Active)

• Gene Name:

  CD47

• UniProt:

  Q08722

• Expression Region:

  19-139aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

• Tag:

  C-terminal 10xHis-tagged

• Type:

  Active Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Immunology

• Relevance:

  Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  ①Measured by its binding ability in a functional ELISA. Immobilized Human CD47 (CSB-MP004940HUd7) at 2 μg/mL can bind Human SIRPA protein. The EC50 is 98.73-112.7 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human CD47 at 2 μg/mL can bind Anti-CD47 recombinant antibody (CSB-RA004940MA1HU) . The EC50 is 1.343-1.561 ng/mL.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  15.1 kDa

• References & Citations:

  "An ovarian tumor marker with homology to vaccinia virus contains an IgV-like region and multiple transmembrane domains." Campbell I.G., Freemont P.S., Foulkes W., Trowsdale J. Cancer Res. 52:5416-5420 (1992)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial