Recombinant Human Tetraspanin-2 (TSPAN2) , partial

Recombinant Human Tetraspanin-2 (TSPAN2) , partial

• CAS Number: 9000-83-3
• Gene Name: TSPAN2
• UniProt: O60636
• Expression Region: 112-188aa
• Organism: Homo sapiens
• Target Sequence: GKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQL
• Tag: Tag-Free
• Source: E.coli
• Field of Research: Stem Cells
• Assay Type: In Stock Protein
• Relevance: May play a role in signalling in oligodendrocytes in the early stages of their terminal differentiation into myelin-forming glia and may also function in stabilizing the mature sheath.
• Purity: Greater than 85% as determined by SDS-PAGE.
• Activity: Not Test
• Length: Partial
• Form: Liquid or Lyophilized powder
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight: 8.8 kDa
• References & Citations: "New genetic associations detected in a host response study to hepatitis B vaccine." Davila S., Froeling F.E., Tan A., Bonnard C., Boland G.J., Snippe H., Hibberd M.L., Seielstad M. Genes Immun. 11:232-238 (2010)
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.